(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1202

AL596167.LIN1202     Location/Qualifiers
FT   CDS_pept        251291..251902
FT                   /transl_table=11
FT                   /gene="lin1202"
FT                   /note="conserved hypothetical protein, similar to B.
FT                   subtilis YsnA protein"
FT                   /db_xref="GOA:Q92CH0"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CH0"
FT                   /protein_id="CAC96433.1"
FT                   /translation="MSKIIIATANKGKAKEFEKIFAKFNIEVATLADFPEIGEIEETGT
FT                   TFAENAALKAETVASLLNQTVIADDSGLIVDVLNGAPGVYSARYAGVAHDDAKNNEKLL
FT                   KNLEGVEPAKRTARFHCTLAVATPSEKTSFYTGEVEGVIAEQLCGTNGFGYDPLFFLPE
FT                   FGLTMAEIPAEKKNEISHRANAIKQLEKDLAEVVEKVTKK"
     atgagtaaaa ttattattgc caccgcaaat aaaggaaaag caaaagaatt cgaaaaaatc        60
     tttgcgaagt ttaatatcga agttgctacc cttgctgatt ttccagaaat tggtgaaatt       120
     gaagaaacag gcacgacctt tgctgaaaat gctgctctta aagcagaaac ggtcgctagc       180
     ttgctaaatc aaacagttat tgctgatgat tcaggtttaa ttgtagacgt gcttaacggg       240
     gctcctggtg tctattctgc acgctatgct ggggtcgctc atgatgatgc aaaaaataat       300
     gaaaaactac ttaaaaattt agaaggcgta gaaccagcaa aaagaactgc tcgtttccac       360
     tgtacacttg ctgtggctac accctctgag aaaacaagtt tttatacagg agaggtagaa       420
     ggagttatcg cagaacaact atgcggtaca aacggcttcg gttatgatcc actatttttc       480
     ttaccagaat tcggtcttac aatggcagaa attccagcag agaaaaagaa tgaaatcagc       540
     caccgagcta atgctattaa acagctagaa aaagatttag cagaagttgt agaaaaagtt       600
     actaaaaagt ga                                                           612
//

If you have problems or comments...

PBIL Back to PBIL home page