(data stored in ACNUC9435 zone)

EMBL: AL596167.LIN1203

AL596167.LIN1203     Location/Qualifiers
FT   CDS_pept        251940..252464
FT                   /transl_table=11
FT                   /gene="lin1203"
FT                   /note="conserved hypothetical protein, similar to B.
FT                   subtilis YsnB protein"
FT                   /db_xref="GOA:Q92CG9"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR028661"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041802"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CG9"
FT                   /protein_id="CAC96434.1"
FT                   /translation="MKLLVVSDSHSERDCLIHLKEKYENTVDAMIHCGDSELEADDPAI
FT                   QGFHTVRGNCDFGGGFPNDWVGEVDGYRILTTHGHLYNIKMTLMNLRYRARELNADFAF
FT                   FGHSHELGVDMLDDTIILNPGSISLPRGRIRIKTYALIDSTPEGIKVRFMDRDDNELTD
FT                   LTQVFPLTKHN"
     atgaaattat tagtagttag cgacagccac tcagaacgtg actgcttaat ccatcttaaa        60
     gaaaaatacg aaaatacagt cgatgccatg attcattgtg gggattctga attagaagct       120
     gatgatccag cgattcaagg atttcatact gttcgaggca actgtgattt tggcggaggc       180
     tttccaaatg attgggtagg ggaagtggat ggctatcgta tcttaaccac acacggacat       240
     ctttataaca tcaaaatgac acttatgaac ttacgctacc gagctcgtga attaaacgct       300
     gatttcgcat tttttggtca ttctcatgaa ctaggcgttg atatgctaga tgacaccatc       360
     attttaaacc caggaagcat ttccttacca agaggtcgca ttcgcattaa aacatacgca       420
     ctcatcgact ctacaccaga aggaatcaaa gttcgcttca tggatcgtga cgataacgaa       480
     ctaactgacc taacacaagt ttttccttta acaaagcaca actag                       525
//

If you have problems or comments...

PBIL Back to PBIL home page