(data stored in ACNUC9435 zone)

EMBL: AL596167.PDHA

AL596167.PDHA        Location/Qualifiers
FT   CDS_pept        96423..97538
FT                   /transl_table=11
FT                   /gene="pdhA"
FT                   /note="highly similar to pyruvate dehydrogenase (E1 alpha
FT                   subunit)"
FT                   /db_xref="GOA:Q92CX7"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CX7"
FT                   /protein_id="CAC96275.1"
FT                   /translation="MASKTKKAIIDVKKQFEAVHKQFELVQILNEKGEIVNPDLMPDLT
FT                   DDELVELMTRMVWTRVLDQRSISLNRQGRLGFYAPTAGQEASQLASHYALEKHDYILPG
FT                   YRDVPQLIWHGLPLTKAFLFSRGHFVGNQFPEDLNVLSPQIIIGAQIVQAAGVALGLKK
FT                   RKKDAVVITYTGDGGSSQGDFYEGMNFAGAYHAPAIFVVQNNKFAISTPREKQSAAETL
FT                   AQKAVAAGIPGVQVDGMDPLAVYAVTKFARERAVAGEGPTLIETMTYRYGPHTLSGDDP
FT                   TRYRTKELDGEWELKDPIVRFRTFLEGKGLWNEEKENAVIDQAKEEIKVAIKEADATPK
FT                   QTVTDLLKNMYETPTAPIKEQLAIYEAKESK"
     atggcttcta aaacaaagaa ggctattatc gacgtaaaga aacaatttga ggctgttcat        60
     aaacaatttg aattagttca aattctaaat gaaaaaggag aaatcgtaaa tccagattta       120
     atgccggatt taactgatga cgagttagta gaattaatga ctcgcatggt ttggactcgt       180
     gtacttgacc aacgttctat ttcacttaac cgtcaaggac gtctagggtt ctatgctcca       240
     actgctggac aagaagcttc ccaacttgca agccactatg cacttgaaaa acatgattat       300
     attcttccag gttaccgtga tgtgcctcaa cttatctggc acggacttcc acttacaaaa       360
     gcgttccttt tctctcgtgg acactttgta ggtaaccaat tccctgaaga tttaaatgta       420
     ttatcaccac aaatcatcat cggtgcacaa atcgtgcaag ctgccggtgt tgctctaggt       480
     cttaaaaaac gtaaaaaaga cgctgttgta atcacttata caggtgacgg tggttcttca       540
     caaggtgact tctatgaagg aatgaacttt gcgggtgctt accatgctcc agcaatcttc       600
     gtagtacaaa acaataaatt cgcgatttct acacctcgtg aaaaacaatc agctgctgaa       660
     acattagctc aaaaagcagt tgcagccgga atcccaggcg tacaagtaga cggaatggat       720
     ccacttgcag tatatgctgt aactaaattc gctcgtgaac gtgcagttgc tggtgaaggc       780
     ccaacattaa tcgaaacgat gacttaccgt tatggtccac atacactttc tggtgatgat       840
     ccaactcgtt accgtacaaa agaacttgac ggagaatggg aacttaaaga tccaatcgtt       900
     cgcttccgta ctttcttaga aggtaaaggc ctttggaacg aagaaaaaga aaatgctgtt       960
     atcgatcaag ctaaagaaga aatcaaagta gcaattaaag aagcagacgc tacaccaaaa      1020
     caaactgtaa ctgatcttct taaaaatatg tacgaaacac caactgctcc tatcaaagag      1080
     caactggcaa tctatgaagc gaaggagtcg aaataa                                1116
//

If you have problems or comments...

PBIL Back to PBIL home page