(data stored in ACNUC9435 zone)

EMBL: AL596167.PDHB

AL596167.PDHB        Location/Qualifiers
FT   CDS_pept        97541..98518
FT                   /transl_table=11
FT                   /gene="PdhB"
FT                   /note="highly similar to pyruvate dehydrogenase (E1 beta
FT                   subunit)"
FT                   /db_xref="GOA:Q92CX6"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CX6"
FT                   /protein_id="CAC96276.1"
FT                   /translation="MAQKTMIQAITDALAVELEKDENVLVFGEDVGKNGGVFRATEGLQ
FT                   EKFGEDRVFDTPLAESGIGGLAIGLALEGFRPVPEIQFFGFVFEVMDSVAGQMARMRYR
FT                   TGGTRTAPITIRAPFGGGVHTPEMHADNLEGLMAQSPGLKVVIPSTPYDAKGLLISAIR
FT                   DNDPVIFLEHMKLYRSFREEVPEGEYTVEIGKAAVRREGTDVSIITYGAMVQESMKAAE
FT                   ALEKDGVSVEVIDLRTISPIDVETIIASVKKTNRAVVVQEAQKQAGIAANIVAEINDHA
FT                   ILSLEAPVMRVAAPDSVFPFSQAETVWLPNHNDIIERVKEVIAF"
     atggcgcaaa aaacaatgat tcaagcgatt acagatgcgc ttgcagtaga acttgaaaaa        60
     gacgaaaacg tattagtttt tggggaagac gttggtaaaa acggcggcgt attccgtgca       120
     acagaaggat tacaagaaaa atttggcgaa gatcgtgtat tcgatactcc tctagcagaa       180
     tctggtatcg gtggtcttgc tatcggtctt gcacttgaag gtttccgtcc agttccagaa       240
     attcaattct tcggtttcgt atttgaagta atggattccg ttgctggtca aatggctcgt       300
     atgcgttacc gtacaggcgg aactcgtact gctccaatta caattcgcgc accttttggt       360
     ggtggagttc atacaccaga aatgcacgct gataacttag aaggattaat ggctcaatct       420
     cctggtttaa aagtggtaat tccttccact ccatacgatg caaaaggtct tttaatctct       480
     gcaattcgtg ataacgatcc tgttattttc ttagagcata tgaaattata tcgttctttc       540
     cgtgaagaag ttccagaagg cgaatacaca gtagaaattg gtaaagcagc tgttcgtcgt       600
     gaaggtactg atgtttctat catcacttac ggtgcaatgg tacaagaatc aatgaaagca       660
     gcagaagctc ttgaaaaaga tggcgtatct gtagaagtta tcgatttacg tacaattagc       720
     ccaattgatg tggaaacaat cattgcttcc gttaagaaaa caaaccgtgc tgtagtagtt       780
     caagaagcac aaaaacaagc aggtattgca gctaatatcg ttgcagaaat taacgaccat       840
     gcaatccttt ctctagaagc accagttatg cgtgttgctg ctccagatag cgtattcccg       900
     ttctctcaag cagaaacagt ttggttacca aatcataacg atatcattga acgagtaaaa       960
     gaagttattg cattttaa                                                     978
//

If you have problems or comments...

PBIL Back to PBIL home page