(data stored in ACNUC9435 zone)

EMBL: AL596167.PDHC

AL596167.PDHC        Location/Qualifiers
FT   CDS_pept        98629..100263
FT                   /transl_table=11
FT                   /gene="pdhC"
FT                   /note="highly similar to pyruvate dehydrogenase
FT                   (dihydrolipoamide acetyltransferase E2 subunit)"
FT                   /db_xref="GOA:Q92CX5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CX5"
FT                   /protein_id="CAC96277.1"
FT                   /translation="MAYSFKLPDIGEGIHEGEIVKWFVQPGDKIEEDESLFEVQNDKSV
FT                   EEITSPVSGTIKEIKVAEGTVATVGQVLVTFDGVEGHEDDAEEESAAPKAESTESTPAP
FT                   AQASGKGIFEFKLPDIGEGIHEGEIVKWFIQPGDKVEEDQSIFEVQNDKSVEEITSPVD
FT                   GTVKDILVSEGTVATVGQVLVTFEGDFEGEASHESTPESPAEEAELTNNDATSAPATGG
FT                   NGTPSSKKDPNGLVIAMPSVRKYAREKDVNIAEVAGSGKNNRVVKADIDAFLNGEQPAA
FT                   ATTTAQTEEKAAAPKAEKAAAKQPVASSDAYPETREKLTPTRRAIAKAMVNSKHTAPHV
FT                   TLMDEIEVTALMAHRKRFKEVAAEKGIKLTFLPYMVKALVATLRDFPVLNTTLDDATEE
FT                   LVYKHYFNVGIAADTDHGLYVPVIKNADKKSVFQISDEINELAGKARDGKLTADEMRHG
FT                   SATISNIGSAGGQWFTPVINYPEVAILGVGRIAQKPIVKDGEIVAAPVLALSLSFDHRV
FT                   IDGATAQKAMNNIKRLLNDPELLLMEV"
     atggcatatt catttaaatt accggatatc ggtgaaggta tccatgaagg tgaaatcgtt        60
     aaatggtttg tacaaccagg cgataagatt gaagaagatg aatccctatt tgaagtacaa       120
     aacgacaaat cagtggaaga aatcacttct ccagtttcag gaacaattaa agaaatcaaa       180
     gttgctgaag gtacagttgc tacagttgga caagtactag taacatttga tggcgtagaa       240
     ggtcacgaag acgacgccga agaagaaagc gcagcaccaa aagcagaatc cacagaatca       300
     actccagcac ccgcacaagc tagcggaaaa ggaatttttg aattcaaatt accagatatt       360
     ggtgaaggaa ttcatgaagg cgaaattgtt aaatggttta ttcaaccggg cgataaagta       420
     gaagaagatc agtccatttt tgaagtacaa aacgacaaat ctgtcgaaga aattacttct       480
     ccagtagatg gaactgttaa agatatttta gttagtgaag gtacagtagc gacagttggt       540
     caagtattag taacatttga aggcgatttt gaaggagaag ctagtcatga atctactcca       600
     gaatccccag cagaagaagc tgaacttaca aacaacgatg caacttccgc tccagctaca       660
     ggtggaaacg gaactccatc atctaaaaaa gatcctaatg gccttgtaat tgcaatgcct       720
     tctgtacgta aatatgctcg tgaaaaagac gttaatatcg ctgaagtagc aggctctgga       780
     aaaaataacc gcgtagttaa agctgatatc gatgctttcc taaacggcga acaaccagct       840
     gcagcaacaa ctactgctca aacagaagaa aaagcagcag caccaaaagc agaaaaagca       900
     gcagcaaaac aaccagttgc aagctccgat gcttacccag aaacacgcga aaaattaaca       960
     ccaactcgtc gtgcgattgc aaaagcaatg gtaaactcaa aacatacagc accacacgtt      1020
     actttaatgg acgaaatcga agtaactgca cttatggctc accgcaaacg tttcaaagaa      1080
     gtagctgccg aaaaaggtat caaacttact ttcttacctt atatggtgaa agctcttgtt      1140
     gcaacgcttc gtgacttccc agtgcttaac acaactttag atgatgcgac agaagaactt      1200
     gtttacaaac attacttcaa cgttggtatc gcagcagata cagaccacgg tttatacgtg      1260
     ccagtaatta aaaatgctga taaaaaatcc gtattccaaa tttctgatga aatcaacgaa      1320
     ctagctggaa aagcacgtga tggtaaatta acagctgacg aaatgcgcca cggttccgca      1380
     actatttcta atatcggttc tgccggcgga caatggttca ctccagtaat taattaccca      1440
     gaagttgcta tcctaggtgt tggtcgtatt gctcaaaaac ctatcgtaaa agatggcgaa      1500
     attgtagcag caccagtact agcgctttcc ttgagctttg accaccgtgt aattgacggc      1560
     gcgactgctc aaaaagcaat gaacaatatt aaacgtttat taaacgaccc agaattatta      1620
     ctaatggagg tgtaa                                                       1635
//

If you have problems or comments...

PBIL Back to PBIL home page