(data stored in ACNUC9435 zone)

EMBL: AL596167.PDHD

AL596167.PDHD        Location/Qualifiers
FT   CDS_pept        100268..101671
FT                   /transl_table=11
FT                   /gene="PdhD"
FT                   /note="highly similar to dihydrolipoamide dehydrogenase, E3
FT                   subunit of pyruvate dehydrogenase complex "
FT                   /db_xref="GOA:Q92CX4"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CX4"
FT                   /protein_id="CAC96278.1"
FT                   /translation="MVVGDFPEERDTIVIGAGPGGYVAAIRAAQLGQKVTIIEKEYYGG
FT                   VCLNVGCIPSKALITIGHRFKEAGHSDNMGITADNVNLDFTKAQEWKGGVVNKLTSGVK
FT                   GLLKKNKVEMLEGEAFFVDDHSLRVIHPDSAQTYTFNNVIIATGSRPIEIPGFKYGKRV
FT                   LSSTGALALTEVPKKLVVIGGGYIGTELGGAFANLGTELTILEGGPEILPTYEKDMVSL
FT                   VKRNLKSKNVEMVTKALAKSAEETENGVKVTYEANGETKTIEADYVLVTVGRRPNTDEI
FT                   GLEQAGVKVTERGLVEVDKQGRSNVSNIFAIGDIVPGVPLAHKASYEAKIAAEAIAGEK
FT                   AENDYTALPAVVFSDPELATVGLTEKEAKEKGFDVKAAKFPFGGNGRALSLDAPEGFVR
FT                   LVTRKEDGLVIGAQVAGMNASDIISEIGLAIESGITAEDIALTIHAHPSLGELTMEAAE
FT                   LALGRPIHM"
     atggtagtag gcgattttcc agaagaaaga gacaccatag tcatcggtgc aggcccaggt        60
     gggtatgtag ccgcaatccg agctgcacaa ctcggacaaa aagttaccat tattgaaaaa       120
     gaatattacg gtggtgtgtg cttaaacgtt ggatgtattc cttctaaagc acttatcaca       180
     atcggtcacc gttttaaaga agctggacac tctgataaca tgggtattac agcggacaac       240
     gtgaacttag atttcacaaa agcacaagaa tggaaaggcg gcgtagttaa caagcttaca       300
     tcaggtgtta aaggccttct taagaaaaat aaagttgaaa tgttagaagg agaagcgttc       360
     ttcgtggatg atcattccct gcgtgtgatc caccctgact ccgctcaaac ttatacattc       420
     aataacgtta tcattgcaac aggatctcgt ccaatcgaaa tcccaggttt caaatatggt       480
     aaacgtgtat taagctcgac tggtgcactt gcattaactg aagttccgaa aaaattagtc       540
     gtaattggcg gcggatatat cggaacagaa ctaggtggag cattcgctaa ccttggtaca       600
     gaactaacta tccttgaagg cggtccagaa atcttaccaa catacgaaaa agacatggtt       660
     tccctagtta aacgtaatct gaaaagcaaa aacgttgaaa tggttactaa agcacttgca       720
     aaatctgctg aagaaactga aaacggcgtt aaagtaactt atgaagctaa cggtgaaaca       780
     aaaactatcg aagctgatta tgttttagta acagtaggtc gtcgtccaaa tacagacgaa       840
     atcggtttag aacaagctgg cgttaaagta acagaacgcg gtttagtaga agttgacaaa       900
     caaggtcgct ctaacgtttc taacattttc gccattggtg acatcgttcc tggtgttcct       960
     ctagctcaca aagctagcta tgaagcaaaa atcgctgctg aagcaattgc tggcgaaaaa      1020
     gcagaaaacg attatacagc acttccagct gttgttttca gtgacccaga acttgcaaca      1080
     gttggtttaa cagaaaaaga agcaaaagaa aaaggctttg atgtaaaagc tgctaaattc      1140
     ccattcggcg gtaacggtcg tgcgctttct ttagatgcac ctgaaggatt tgttcgtcta      1200
     gttactcgta aagaagatgg cctagttatc ggtgcacaag ttgccggaat gaacgcttct      1260
     gatattattt cagaaatcgg cttagcaatc gaatcaggta ttacagctga agacatcgcg      1320
     cttactatcc acgctcatcc atcccttgga gagcttacaa tggaagcagc tgaacttgct      1380
     ttaggtcgtc caattcacat gtaa                                             1404
//

If you have problems or comments...

PBIL Back to PBIL home page