(data stored in ACNUC9435 zone)

EMBL: AL596167.PHES

AL596167.PHES        Location/Qualifiers
FT   CDS_pept        226944..227996
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /product="phenylalany-tRNA synthetase alpha subunit "
FT                   /db_xref="GOA:Q92CI7"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CI7"
FT                   /protein_id="CAC96415.1"
FT                   /translation="MLEQLQTLKSEAETQINEAADLKTLNDLRVKYLGKKGPMTEIMKQ
FT                   MGKLSAEERPKMGSLANEVRTALTEAISSKQEILETAAINEKLKSETIDVTLPGTAPSI
FT                   GTKHLLTQVIEEMEDMFIGMGYEIAEGPEVELDYYNFEALNLPKDHPARDMQDSFYITE
FT                   NTLLRTQTSPVQARTMEKHDFSKGPIKVICPGKVYRRDNDDATHSHQFTQIEGLVVGEN
FT                   ITFADLKGTLTVLAKTMFGEEREIRLRPSFFPFTEPSVEMDISCFKCGGKGCRVCKGTG
FT                   WIEILGSGMVHPNVLEMSGIDSTRYSGFAFGLGPERVAMLKYAVDDIRHLYTNDLRFTK
FT                   QFQSTETGEI"
     atgttagagc aattacaaac gctgaaaagt gaagcagaaa cgcaaattaa cgaagcagca        60
     gacttaaaaa cattgaacga cttacgggta aaataccttg gtaaaaaagg cccgatgacc       120
     gaaatcatga aacaaatggg gaaactttcc gcagaagaaa gaccaaaaat gggttcactt       180
     gctaatgaag taagaacagc cttaacagaa gcgatttcca gcaaacaaga aattctggaa       240
     acagcagcaa ttaatgaaaa attaaaatca gaaacaatcg atgttacttt accaggcaca       300
     gcgccaagca tcggaacaaa acatttacta acacaagtaa ttgaagaaat ggaagatatg       360
     ttcattggta tgggttatga aatcgcagaa ggaccagaag tagaactgga ttactataac       420
     ttcgaagcat taaaccttcc aaaagatcac ccagctcgtg atatgcaaga tagcttctat       480
     attacagaaa atactttatt acgtactcaa acatcacctg tacaagcaag aacgatggaa       540
     aaacatgact tctctaaggg accaatcaaa gttatctgtc caggtaaggt ataccgccgc       600
     gacaacgatg atgcaactca ctcccaccaa tttacgcaaa tcgaagggct agttgttggt       660
     gaaaacatca cttttgctga tttaaaaggg acgctgactg ttcttgctaa aactatgttt       720
     ggtgaagaac gcgaaattcg ccttcgtcca tcattcttcc cattcactga gccgtctgtt       780
     gaaatggata tttcttgttt caaatgtggt ggtaaaggtt gccgcgtttg taagggaaca       840
     ggttggattg aaattttagg aagcggtatg gtacatccaa acgtactaga aatgtccggt       900
     attgattcca ctcgttacag cggatttgct tttggcttag gacctgaacg tgttgcgatg       960
     ttgaaatacg cagtggatga tattcgccac ttatatacga atgatttacg ctttacgaag      1020
     caattccaaa gcacagaaac gggggaaatc taa                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page