(data stored in ACNUC9435 zone)

EMBL: AL596167.PHET

AL596167.PHET        Location/Qualifiers
FT   CDS_pept        227996..230404
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /product="phenylalanyl-tRNA synthetase beta subunit"
FT                   /db_xref="GOA:Q92CI6"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CI6"
FT                   /protein_id="CAC96416.1"
FT                   /translation="MLVSYNWVKEFFQDFPLTAEELGEAITRTGIEIEGVEELSASLKN
FT                   VVVGEVLSCERHPDAEKLNKCLVQTDEEEPVQIICGAPNVAAGQKVIVAKVGARLPGGL
FT                   KIKRAKLRGEVSEGMICSLAELGFESKVVPKAYADGIYVLPEHVETGVSAITLLGLDDA
FT                   ILDMAITPNRADALSMNGVAHEVGAIIHQKPAQPTEPDVSEKGKADDFISVEVENPTET
FT                   PYYAIKMVENIEIKESPLWLQTKLMKAGIRPHNNVVDVTNYINLLYGQPLHSFDYDKIG
FT                   SKKIVVRSAKDQEEITTLDGEKRILQTGHTVITNGTEPIAIAGVMGGEFSEVTETTTTV
FT                   ALEGAIFSSSSVGKASRELYLRTEASIRYDKGSDAWKVEKALAHGGALIAELSGGTLVG
FT                   GVVEVDNREKAVNKIETSLTRINRILGTEISLSEIETIFDRLGFVLEVKEDTLIIEVPT
FT                   RRWDITIEADILEEVARIYGYDEIPVTLPATSTTGGLSDSQKARRVMRAYLEGAGLNQA
FT                   LTYSLTSKKDATRLALSDEKTVALSMPMSEEHSHLRTSIVPQLIRSASYNIARKNMDVA
FT                   LYEMGTVFYATEGDNLPIEQEHLAGLITGNWHTADWQKTPKPVDFFVLKGIVEGLVNKL
FT                   GIEAELHWKQIEKEELHPGRTASIQLEGKEIGYLGALHPAVEASYDLKETYVFEINVKA
FT                   LLDATKEKVVYHPIPRYPEMTRDLALLVDKDTDHATISQVIKEHGGNLLVDIELFDIFE
FT                   GESLGENKKSLAYTLTFLDSERTLVEEDVQKATNKVVEALQAKLHAIIR"
     atgttagttt catataattg ggtcaaagaa tttttccaag acttcccgtt aacggcggaa        60
     gagctaggag aagcaattac aagaaccgga attgaaattg aaggcgtaga agaattaagc       120
     gctagtttga aaaatgtcgt ggtaggcgaa gtattatcat gtgaacgcca tccagatgca       180
     gaaaaattga acaaatgcct tgtccaaact gacgaagaag agccagttca aattatttgc       240
     ggagctccaa acgttgctgc aggtcaaaaa gtaatcgtag ccaaagttgg tgcaagactt       300
     ccaggcggac ttaaaatcaa acgcgcaaaa ttacgcggcg aagtttcaga aggaatgatt       360
     tgctcacttg ctgaacttgg ctttgaaagt aaagttgtac caaaagctta tgcggacggc       420
     atttacgttt taccagagca tgttgaaaca ggcgtgagcg caattacttt acttggctta       480
     gatgatgcga ttctcgatat ggcaattaca ccaaaccgcg cagatgcttt aagcatgaac       540
     ggcgtagctc atgaagtagg cgcaattatc catcaaaaac cagcgcaacc aaccgagccc       600
     gatgtatctg aaaaaggtaa agcggacgat tttatttctg tagaagtaga aaatccaaca       660
     gaaacacctt attatgctat taaaatggtt gaaaacatcg aaattaaaga atcacctcta       720
     tggcttcaaa caaaattaat gaaagcaggc atccgtccac ataataacgt agtcgatgta       780
     acaaactaca ttaatttatt atacggacaa ccactgcatt cgtttgacta tgataaaatc       840
     ggtagtaaaa aaatcgtcgt tcgttccgca aaagaccaag aagaaattac cacacttgat       900
     ggcgagaaaa gaatattaca aacaggacac actgttatta ctaatggaac tgaaccgata       960
     gcaattgctg gggttatggg cggagagttt tctgaagtaa ctgaaacgac aacaactgtg      1020
     gcactggaag gagctatttt cagtagttca tctgttggaa aagcatctcg cgaattatat      1080
     ttacgtacag aagcaagtat tcgatatgat aaaggttctg atgcttggaa agtagaaaaa      1140
     gcacttgcac acggcggagc acttatcgct gaacttagcg gcggaacgct tgttggcggc      1200
     gtagtagaag tagataatcg tgaaaaagca gtaaataaaa tcgaaacaag cttaacacgt      1260
     attaaccgta ttttaggaac ggagatttcc ctttccgaaa tagaaacgat ttttgatcgc      1320
     ttaggatttg tattagaagt taaagaagac acattaatta ttgaagtacc gactagacgt      1380
     tgggacatta caattgaagc ggatattttg gaagaagttg cacgtattta tggttatgat      1440
     gaaattcctg tcacacttcc agcaacgagc acaactggtg gattatctga cagccaaaaa      1500
     gctcgtcgtg taatgcgcgc ttatttagaa ggagcgggac ttaaccaagc attaacgtat      1560
     tccttaacat ccaaaaaaga tgcgactcgt ttagcgttat ccgatgaaaa aacagtggcg      1620
     ctttcaatgc caatgagtga agaacatagc catttaagaa caagtatcgt cccacaatta      1680
     attcgtagcg caagttataa tatcgctcgt aaaaatatgg acgtagcact ttatgaaatg      1740
     ggaaccgtgt tctacgcaac agaaggtgac aatttaccaa tcgaacaaga gcatttagct      1800
     ggcttaatta ctggaaattg gcacacagct gattggcaaa aaacaccaaa accagtagac      1860
     ttctttgttt taaaaggaat tgtagaaggt ttagtgaaca aacttggaat cgaagccgaa      1920
     ctgcactgga agcaaatcga aaaagaagaa ctgcatccag gaagaacagc aagcatccaa      1980
     ttagaaggaa aagaaatcgg ttatcttgga gcgcttcatc cagcagtgga agcaagctac      2040
     gatttaaaag aaacgtatgt atttgaaatt aatgtaaaag cgttacttga tgcaacgaaa      2100
     gaaaaagtag tttatcatcc aattccacgc tacccagaaa tgacacgcga cttggcctta      2160
     cttgtggata aagatactga ccatgctaca atctctcaag taatcaaaga gcacggcggg      2220
     aatctcttag tcgacattga actttttgat attttcgaag gagaaagttt aggcgaaaac      2280
     aaaaaatcac tcgcttatac gttaactttc cttgatagcg aaagaacact tgtcgaagaa      2340
     gacgtacaaa aagcaactaa caaagtagta gaagcattac aagcaaaact acatgctatt      2400
     atccgctag                                                              2409
//

If you have problems or comments...

PBIL Back to PBIL home page