(data stored in ACNUC9435 zone)

EMBL: AL596167.PTSH

AL596167.PTSH        Location/Qualifiers
FT   CDS_pept        59521..59787
FT                   /transl_table=11
FT                   /gene="ptsH"
FT                   /product="PTS phosphocarrier protein Hpr (histidine
FT                   containing protein)"
FT                   /db_xref="GOA:P0A439"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/Swiss-Prot:P0A439"
FT                   /protein_id="CAC96232.1"
FT                   /translation="MEQASFVVIDETGIHARPATLLVQAASKYSSDVQIEYTGKKVNLK
FT                   SIMGVMSLGIGKGADITIYTEGSDEKEAIEGLTEVLKKEGLAE"
     atggaacaag caagttttgt agtaatcgat gaaacaggaa ttcacgcacg cccagcaact        60
     ctattggtgc aggctgcaag taaatacagc tctgacgttc aaattgaata cactggcaaa       120
     aaagtaaatc ttaaatcaat catgggtgtt atgtcccttg gtattggtaa aggcgctgac       180
     atcactatct atactgaagg tagcgacgaa aaagaagcaa ttgaaggact aactgaagtt       240
     cttaagaaag aaggattggc tgaataa                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page