(data stored in ACNUC9435 zone)

EMBL: AL596167.TAGD

AL596167.TAGD        Location/Qualifiers
FT   CDS_pept        136985..137368
FT                   /transl_table=11
FT                   /gene="tagD"
FT                   /note="highly similar to glycerol-3-phosphate
FT                   cytidylyltransferase (gct), CDP-glycerol pyrophosphorylase
FT                   (teichoic acid biosynthesis protein D)"
FT                   /db_xref="GOA:Q92CU5"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR006409"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:Q92CU5"
FT                   /protein_id="CAC96307.1"
FT                   /translation="MKKVITYGTFDLIHWGHIRLLERAKALGDYLIVAISTDEFNRIKH
FT                   KEAYHNFEHRKLILEAIRYVDEVIPESNWEQKLEDVKNRDIDIFVMGDDWEGEFDFLKP
FT                   YCEVVYLPRTDGISTSKIKDDLK"
     atgaagaaag taattacata tggcacattt gatttaattc actgggggca tattcgttta        60
     ttagaacgag caaaagcttt aggtgattac cttattgtag ccatttcaac cgatgaattt       120
     aatcgaatca aacacaaaga agcataccat aactttgaac atcgcaaatt aattttagag       180
     gcaatcagat atgtcgatga agtgattcca gaaagtaact gggaacaaaa attagaagat       240
     gttaaaaatc gtgatattga tatttttgtg atgggtgatg attgggaagg cgaatttgac       300
     ttcttaaaac cttattgtga agttgtttat ttaccacgga cagacggtat ttctacttcc       360
     aagattaaag atgatttaaa atag                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page