(data stored in ACNUC9435 zone)

EMBL: AL596167.UVRC

AL596167.UVRC        Location/Qualifiers
FT   CDS_pept        245805..247616
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /note="highly similar to excinuclease ABC subunit C"
FT                   /db_xref="GOA:Q92CH5"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q92CH5"
FT                   /protein_id="CAC96428.1"
FT                   /translation="MSSEHIQNKLALLPDQPGCYLMKDRQGTIIYVGKAKVLKNRVRSY
FT                   FSGTHDSKTQRLVQEIVDFEYIVTSSNVEALLLEINLIKKHDPRFNIRLKDDKTYPFIK
FT                   ITNERHPRLIITRQVKKDKGKYFGPYPNVYAANEVKRILDRLYPLRKCSTLPNKVCLYY
FT                   HLGQCLAPCVFDVEASKYKEMQDEIVAFLNGGYKTVKNDLMKKMQEAAENMEFEKAGEF
FT                   RDQINAIETTMEKQKMTMNDFVDRDVFGYAIDKGWMCVQVFFIRQGKLIERDVSQFPFY
FT                   NDADEDFLTFIGQFYQKANHIPPKEIYLPDDVDSEAVQAVVPDTKIIVPQRGNKKELVK
FT                   LAYKNAKIALNEKFMLLERNEERTVGAVERLGEAMGIPTPSRVEAFDNSNIHGTDPVSA
FT                   MVTFLDGKPSKNDYRKYKIKTVEGPDDYATMREVIRRRYWRVLKEGLPMPDLILIDGGK
FT                   GQIDSAKDVLTNELGLDIPVAGLAKDDKHRTSQLLFGDPLEIVPLERNSQEFYLLQRMQ
FT                   DEVHRFAITFHRQLRSKTGFQSILDGIPGVGPGRKKKLLKHFGSMKKLKEASVEEIKEA
FT                   GVPLNVAEEVHKHITAFNEKAKNTEQK"
     atgtcttctg aacatatcca aaataaatta gcgcttctgc cggaccaacc tggttgttat        60
     ttgatgaaag atagacaagg aacaattatt tatgttggga aagcaaaagt gttgaaaaat       120
     cgcgtgcgtt cgtatttttc aggtacgcac gatagtaaaa cgcaacgtct agtccaagaa       180
     attgtggact ttgaatatat cgtaacttca tccaacgtag aagcattgct acttgaaatt       240
     aatttgataa aaaaacatga cccacgcttc aatattcgct taaaagacga taaaacttat       300
     ccgttcatta aaattacaaa cgaacgacat ccgcgactaa ttattacccg ccaagtaaag       360
     aaagataaag ggaaatattt cggtccgtat ccaaatgtct acgctgcaaa tgaagtgaaa       420
     cgcattctag accgactgta tccacttcga aaatgtagta cattaccaaa taaagtgtgt       480
     ttgtactatc atctcggaca atgccttgcc ccgtgtgtat ttgacgtgga agcaagtaag       540
     tataaagaaa tgcaagacga aattgtggca ttcttaaacg gtggctataa aaccgttaaa       600
     aatgatttaa tgaaaaaaat gcaagaagcc gcagaaaata tggaattcga aaaagctggt       660
     gaattccgcg accaaatcaa cgccatcgaa acaacaatgg aaaaacaaaa aatgacgatg       720
     aacgatttcg ttgaccgcga tgtcttcggt tacgccattg ataaaggctg gatgtgcgtc       780
     caagtattct tcattcgcca aggaaaactc attgagcgcg atgtttccca gtttccattt       840
     tacaacgatg ctgatgaaga cttcctcaca tttatcggcc agttttatca aaaagcaaac       900
     catatcccac ctaaagaaat ttatttgcca gatgatgttg atagcgaagc cgttcaagcc       960
     gtcgttcccg acacaaaaat catcgtacca cagcgcggaa ataaaaaaga actcgtgaaa      1020
     cttgcttaca aaaatgccaa aatcgctcta aacgagaaat ttatgctact tgaacgcaac      1080
     gaagaacgga cagtcggggc agttgaacga cttggtgaag cgatggggat tccaacacca      1140
     tcacgcgtcg aagcatttga taactcgaat attcacggta cagatcccgt ttctgcaatg      1200
     gtcacattcc tagacggaaa accaagtaaa aacgattacc gcaaatacaa aatcaaaacc      1260
     gtggaaggac cggatgatta cgcaacgatg cgagaagtta tccgccgtcg ttactggcgc      1320
     gtacttaaag aaggcctacc aatgccagat ctaatattaa ttgatggtgg gaaaggacaa      1380
     attgatagcg ccaaagacgt cctaacaaac gaactcggct tagatattcc agtagccgga      1440
     ctcgcaaaag acgataagca tcgtactagc caactattat tcggtgatcc tttagaaata      1500
     gttccactcg aaagaaacag ccaagaattc tatttactgc aacgaatgca agatgaagtc      1560
     caccgtttcg ctatcacatt ccaccgccaa ctacgcagca aaacagggtt ccagagcatt      1620
     cttgacggca ttcctggcgt aggacctggc cgcaagaaaa aactactgaa acattttggc      1680
     tccatgaaga aattaaaaga agcatcagtt gaagaaatta aagaagctgg cgttccactt      1740
     aatgtggcag aagaagtgca taaacatata accgctttta acgaaaaagc caaaaatacc      1800
     gaacaaaaat ag                                                          1812
//

If you have problems or comments...

PBIL Back to PBIL home page