(data stored in ACNUC9543 zone)

EMBL: AL844507.PE1

AL844507.PE1         Location/Qualifiers
FT   CDS_pept        join(21361..26364,27295..28653)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0800100"
FT                   /product="erythrocyte membrane protein 1, PfEMP1"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0800100"
FT                   /db_xref="GOA:Q8IAK1"
FT                   /db_xref="InterPro:IPR004258"
FT                   /db_xref="InterPro:IPR008602"
FT                   /db_xref="InterPro:IPR029210"
FT                   /db_xref="InterPro:IPR029211"
FT                   /db_xref="InterPro:IPR041480"
FT                   /db_xref="InterPro:IPR042202"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAK1"
FT                   /protein_id="CAD51363.1"
FT                   /translation="MAAAGGGGKDKYKNAQDAKHLLDIIGEDIYKIANDAALKRSGSEL
FT                   KGLLSLAKFEKNPPDKQTPEDPCDLDYKYHTNVTSNVIEPCNKRSGKRFSEVSGAECAN
FT                   NRIKGNKGSNGDACAPFRRLHVCDRNLEQIDPAKITATHNLLVDVCQAAKFEGQSITQD
FT                   YPKYLATYNDSPSQICTMLARSFADIGDIVRGKDLFRGYDDEEKNRRKKLEQKLKVIFG
FT                   HIYEELKKHKKLKEEAEERYKKDGDNYYKLREDWWALNRQEIWKAITCGHPGGTYFRQT
FT                   ACGGGTTPTPNKCRCATNDVPTYFDYVPQYLRWFEEWAEDFCRKRKYKLENAIEKCRGK
FT                   TKGEKYCDLNGFDCTQTASGEKKFVKGHNCHNCSVTCIPFGPWIDNQKKEFLKQRNKYQ
FT                   NEISSNSRKKRSTSNNNYKGYDEEFYKILKEDYGDVEQFLEKLSREGICQSQPTVGNQK
FT                   ADAANFTKDNPAKTFSHTEYCQACPWCGVVCKSGNCTKNPEGSCTEQIRKKVYDDSNTT
FT                   TIPVLTPEKGKTSILQKYKTFCEKPEKHNQINNWECHYEKTDISNNCILGKWEKFQKGQ
FT                   EVMVYHPFFWKWVTEMLDDSIKWRKELDNCLKNENKQCISKCNGKCDCYKRWVEQKKEK
FT                   EWTQIKDHFGKQEDMKEQIRGADPGIILEGVLDIEDLFENIKDTYGDVKEIDHIKKLLE
FT                   EETTVDADNQNKTTIDKLLDHEDKDAKGCLQKQNECKEQERDGGARSDSQEPTPRSEVK
FT                   PDSEDLDDDDEDDPDEEKSEEVENPEDQGEEEGTKQGSGEKKVDGTEAVQETVAEVTPE
FT                   KKDEVNPCEIVKTLFEKPENLSDACGLKYGPGGKERYSQWKCIPTKPNSDNKGEVGSAG
FT                   RVARSAPSGEKGSICVPPRRRRLYVKDLETLGDSEVTQVQLRDAFIKCAAVETFFLWDR
FT                   YKKEKEKKKPQEGVLQLLGTVGTPPTDDEEDPPEKMLQKGEIPEEFKRQMFYTLADYKD
FT                   ILFGDQEVIKTLKDSGDENIKDISEKIKKTLNGDNNQESGSSPSLSGKKTTPKDWWETY
FT                   GKDIWEGMVCALTYKNSGDKKIEQVKTADDGEDLFQKLKTQYEYNTVTLKDENSGTEGA
FT                   KPFTPKTVSSSSGEKNPPKLSDFVLRPPYFRYLEEWGETFCRQRARMLDKIKKDCNVEE
FT                   NDNRPGGGITKQYSGDGESCKDYLPDDPTTLPDLVSSCPKSCSSYRKWINKKKDEFVEQ
FT                   QNAYTEQQNKCQSKSDKAKSDNGFYTRLQNLPDAAAFLKTLGSCSKNDIPEYKIDFDVN
FT                   GETFRYEKYCGTCPEFKINCTKVKCTSGDMQNGCKDNKINAANFKTMAQSTEINMLVSD
FT                   NSGNGSQNDLKDCKTSGIFKGFREDVWTCGKVCGYNVCKPKNVNGQNGDGNQILLFNAL
FT                   LKRWVEYFLEDYKKIKHKISHCKNSSEGHTCIKNCVEQWISTKRTEWETIRGRFNDQYK
FT                   SNDSDVYPVRSFLETWIPKIPVANANNDGKKLIKLSKFDNFCSCSASAHSPNGKDDAID
FT                   CMINRLQDKIDKCKEKHPQPSAENQTTCDESTLVEDVDDYEEQNPENKVGKPAICGNVD
FT                   TTEPVKEEDEEECKAAESPAEPEQAAEEESVPAAETKDTENQPPQAPDVGPPPLAPAPA
FT                   DQPLDPTILQTTIPFGIAIALTSIVFLFLKKKTKSTIDLLRVINIPKSDYDIPTKLSPN
FT                   RYIPYTSGKYRGKRYIYLEGDSGTDSGYTDHYSDITSSSESEYEELDINDIYVPRAPKY
FT                   KTLIEVVLEPSGNNTTASGNNTTASDTQNDIQNDIPSDIPKTPSDTPPPITDDEWNQLK
FT                   DEFISQYLQSEQPKDVPNDYSSGDIPLNTQPNTLYFDKPQEKPFITSIHDRNLYSGEEY
FT                   NYDMFNSGKNGPYSDKNDLYSGNHDSLSGNRDPTSANHDSYSGNHHPYSGIDLINDSIS
FT                   GNQHIDIYDELLKRKENELFGTNNPKRTSTYSVAKLTNSDPIHNQLELFHTWLDRHRDM
FT                   CEKWENHHERLAKLKEEWENETHSGNTHPSDSNKTLNTDVSIQIDMDHEKRMKEFTNMD
FT                   TILEDLDKPFNEPYYYDMYDDDIYYDVNDHDTSTVDSNAMDVPSKVQIEMDVNTKLVKE
FT                   KYPIGDVWDI"
     atggcggctg caggtggggg tggtaaggat aagtataaaa atgcccagga tgccaagcat        60
     cttttggata taattggaga agatatatac aaaatagcaa atgatgctgc tctaaaacgt       120
     agtgggagtg agttaaaagg attgttgtca ctagcaaaat ttgagaaaaa tccaccggat       180
     aaacaaacac cagaagatcc atgcgatctt gattataaat atcatactaa tgttactagt       240
     aacgtaattg aaccgtgcaa caaaagatca ggaaaacgtt tttctgaagt aagtggcgca       300
     gaatgtgcta ataatagaat aaaaggtaat aaaggtagta atggtgacgc ttgcgcgccg       360
     ttcagacgat tacatgtatg cgacagaaac ctagaacaga tagatcctgc aaaaataaca       420
     gcaacacata atttattggt agatgtgtgt caggcagcaa aatttgaagg acaatcaata       480
     acacaagatt atccaaaata tctagcaaca tataatgatt ctccttctca aatatgtact       540
     atgttggcac gaagttttgc tgatattgga gacattgtac gcggcaaaga tctatttcgt       600
     ggttatgatg atgaagaaaa aaatcgaaga aaaaaattag aacagaaatt gaaagttatt       660
     ttcgggcata tatatgaaga attgaagaag cacaaaaagc ttaaggagga agcagaagaa       720
     cgctacaaaa aagacggtga taattattat aaattacgag aagattggtg ggcacttaat       780
     agacaagaaa tatggaaagc tatcacgtgc ggacatccgg gtggtacata ttttcgacaa       840
     acagcgtgtg gtggaggaac aactccgact cctaataaat gccgatgtgc gacaaatgat       900
     gtacctacat attttgatta tgtgccgcag tatcttcgct ggttcgagga atgggcagaa       960
     gatttttgtc gtaaacgaaa atataaatta gaaaatgcta tagaaaaatg tcgtggaaaa      1020
     acgaaaggtg agaaatattg tgatcttaat ggatttgatt gtacgcaaac agctagcgga      1080
     gaaaagaaat ttgttaaagg tcataattgc cataactgtt ctgttacatg tattcccttt      1140
     gggccctgga tagataacca aaaaaaagaa tttttaaaac aaagaaataa ataccaaaat      1200
     gaaatatcaa gtaatagtag gaaaaaaaga agtacaagta ataataatta taaaggatat      1260
     gatgaagaat tttataaaat acttaaagag gattatggag atgtcgaaca gtttttagaa      1320
     aaattaagta gagaaggaat atgtcaatct caacctacag taggaaatca aaaagcagac      1380
     gctgctaatt tcactaaaga taatcctgca aaaacatttt ctcatacgga atattgccaa      1440
     gcatgtccat ggtgtggagt tgtttgcaag agtggtaact gtacaaaaaa cccagaagga      1500
     tcatgcaccg aacaaattcg aaagaaagtt tacgatgatt caaatactac cactatacca      1560
     gtacttaccc cagaaaaagg aaagacaagt atactacaaa aatataaaac gttttgtgaa      1620
     aaacctgaaa agcataacca aattaataat tgggaatgtc attatgaaaa aaccgatata      1680
     agtaataatt gcatactagg aaaatgggaa aagtttcaaa agggacaaga agttatggtc      1740
     tatcatcctt ttttttggaa gtgggttacc gaaatgttgg acgattctat aaaatggagg      1800
     aaagaacttg ataattgcct aaaaaatgag aacaaacaat gtataagcaa atgtaatggt      1860
     aaatgtgatt gttataaacg atgggttgaa caaaaaaaag aaaaggaatg gacacaaata      1920
     aaagaccatt ttggcaagca agaagatatg aaagaacaaa ttcgaggagc agatcctggc      1980
     ataattcttg aaggtgtttt ggacatagag gatcttttcg aaaatattaa agatacttat      2040
     ggggacgtaa aagaaataga tcacattaag aaactgttgg aagaagaaac aactgttgat      2100
     gccgacaatc aaaataagac cacaattgat aaattgctcg atcacgaaga taaagatgcc      2160
     aaaggatgcc tacaaaaaca gaatgaatgc aaagaacaag aacgagatgg tggtgcccgc      2220
     tcggactccc aggaacccac accacgttct gaagttaaac ccgactcaga agacctcgac      2280
     gacgacgacg aagacgaccc cgacgaggag aagtcggagg aggtggaaaa cccggaagac      2340
     cagggggagg aggaaggcac aaaacagggg tcgggggaaa agaaggtgga tgggacagag      2400
     gccgtacaag aaaccgtcgc agaggtaaca ccggaaaaaa aagacgaggt gaatccatgt      2460
     gaaatagtaa aaacactatt tgaaaaaccg gaaaatttgt ccgacgcttg tggtctaaaa      2520
     tacggcccag gcggaaaaga aagatacagt caatggaagt gcataccaac caaaccaaat      2580
     agtgacaaca agggcgaggt tggtagtgct ggtcgtgtcg cacgtagtgc ccctagtggt      2640
     gaaaaaggtt ccatttgtgt gccacccagg agacgacgat tatatgtaaa ggatttagaa      2700
     acacttggtg atagtgaagt aacacaagta caattacgag atgcttttat taaatgtgct      2760
     gccgttgaaa ccttcttcct atgggataga tataaaaaag aaaaagagaa aaaaaaacca      2820
     caagaaggtg tgttacaact actcggcaca gttggtaccc cccctactga tgatgaggag      2880
     gacccccccg aaaaaatgtt acaaaaaggt gaaatccctg aagaatttaa gcgtcagatg      2940
     ttctatacat tagcagacta caaagatata ttatttggtg atcaagaggt gattaagacg      3000
     ctaaaagata gtggtgatga aaatataaaa gatatatcgg agaaaataaa aaaaacttta      3060
     aacggtgaca acaaccaaga aagtggtagc tccccatctc ttagtggcaa aaaaaccaca      3120
     ccaaaagact ggtgggaaac atatggaaaa gatatttggg aaggaatggt ttgtgctcta      3180
     acatataaaa atagtggaga caaaaaaata gaacaggtta aaactgcgga cgacggcgaa      3240
     gatcttttcc aaaaactcaa aacccaatac gaatacaaca ccgtcacact taaagatgaa      3300
     aatagtggta ctgaaggcgc caaacccttc acccccaaaa ccgtctcatc ctctagtggt      3360
     gaaaaaaacc cccccaaatt gagtgatttc gtgttacgcc ccccctactt ccgatacctt      3420
     gaagaatggg gtgaaacatt ttgtcgacaa agggcgcgga tgttggataa gattaaaaaa      3480
     gattgcaacg tggaagaaaa tgataaccgt cctggtggtg gtataacaaa acaatatagt      3540
     ggggatggag aaagttgtaa agattatctt cctgacgatc ctactacact tccggattta      3600
     gtttccagtt gtcccaaatc ttgtagttct tatagaaaat ggataaataa aaaaaaagac      3660
     gaattcgttg aacaacaaaa tgcatatact gaacaacaaa ataaatgcca atcgaaaagt      3720
     gataaagcta aaagtgataa tggattttat acaagattac aaaatctccc tgacgctgca      3780
     gcatttttaa aaacgttagg atcatgttct aaaaatgata ttccagagta taaaatagat      3840
     tttgatgtaa acggcgaaac atttagatat gaaaaatatt gtggtacatg tcctgaattt      3900
     aaaataaatt gtacaaaagt taaatgcact agtggtgata tgcaaaatgg gtgcaaagat      3960
     aataaaatta atgcagcaaa ttttaaaaca atggcacaat ctactgaaat aaatatgctt      4020
     gtgagtgata acagtggaaa tggatctcaa aatgatttaa aggattgtaa aacttcaggt      4080
     atctttaaag gttttagaga agatgtatgg acatgtggta aggtatgtgg ttataatgta      4140
     tgtaaaccga aaaatgttaa tgggcaaaac ggtgatggga atcaaatttt attattcaat      4200
     gcattgctta aacgttgggt agaatatttt ttagaggatt ataagaaaat taaacataaa      4260
     atttcacatt gtaagaatag tagtgaagga cacacatgta taaaaaattg tgtagaacaa      4320
     tggataagta cgaaaaggac agaatgggag actatacgag gtcgtttcaa tgatcaatat      4380
     aaaagtaatg attcagatgt ttacccagtg agaagttttt tggagacctg gatacctaaa      4440
     attcctgttg caaacgctaa caatgatggt aaaaagttaa taaaattaag taagttcgat      4500
     aatttttgtt catgtagtgc cagtgcgcac tcaccaaatg gtaaagacga tgctatagat      4560
     tgtatgatta atagacttca agataaaatt gataagtgta aagagaaaca cccccaacct      4620
     agtgccgaaa accaaacaac ttgtgatgaa tccaccctcg ttgaagacgt tgatgattat      4680
     gaggaacaaa acccagaaaa caaagtggga aaaccagcaa tttgtggaaa tgtggataca      4740
     acagaaccag tcaaagagga agatgaagag gaatgtaaag ctgcagaatc ccctgctgaa      4800
     cccgaacaag ctgcagaaga agaaagtgta ccagcagcag aaaccaaaga cacagagaac      4860
     caacccccac aggcaccaga cgtgggacct ccacccctgg caccggcccc tgcggatcaa      4920
     cctttggacc cgactatcct acaaacgact attccttttg gaatagctat tgcgttaact      4980
     tcgatagtgt ttttattttt gaagaaaaaa accaaatcta ctattgatct tttgcgtgtt      5040
     attaatatac ccaaaagtga ttatgatata ccgacaaaac tttcacccaa tagatatata      5100
     ccttatacta gtggtaaata cagaggcaaa cggtacattt accttgaagg agatagtgga      5160
     actgatagtg gttacaccga tcattatagt gatattactt catcttccga aagtgagtat      5220
     gaagaattgg atattaatga tatatatgta ccacgtgctc ctaaatataa aacattgatt      5280
     gaagtagtac ttgaacctag tggtaacaac acaacagcta gtggtaacaa cacaacagct      5340
     agtgatacac aaaatgatat acaaaatgat atacctagtg atataccaaa aacacctagt      5400
     gatacaccac cacccattac tgatgatgag tggaatcaat tgaaagatga atttatatca      5460
     caatatctac aaagtgaaca accaaaggat gtaccaaatg attatagtag tggagatatt      5520
     ccattgaata cacaaccgaa tactttatat tttgataaac ctcaagaaaa accttttatt      5580
     acttctattc atgatagaaa tttatatagt ggagaagaat acaattatga tatgtttaat      5640
     agtggtaaaa atggtccata tagtgataaa aatgatttat atagtggtaa tcatgattca      5700
     ttaagtggta atcgtgatcc aacaagtgct aaccatgatt cttatagtgg taaccatcat      5760
     ccttatagtg gtatagattt aattaatgat tcgataagtg gtaatcaaca tattgatata      5820
     tatgatgaat tgttgaaaag aaaagaaaac gaattatttg ggacaaataa tccaaaacgt      5880
     acaagtacat atagtgttgc caaactaaca aatagtgacc ccatccacaa ccaactggaa      5940
     ctattccata catggctaga tagacataga gatatgtgcg aaaagtggga aaatcatcac      6000
     gaacgattag ccaaattgaa agaagagtgg gaaaatgaga cacatagtgg taacactcac      6060
     cctagtgata gtaacaaaac gttaaatact gatgtttcta ttcagataga tatggatcat      6120
     gaaaaacgaa tgaaggaatt tactaatatg gatactatct tggaggatct ggacaaacca      6180
     tttaatgaac cctactatta tgatatgtat gacgatgata tttattatga tgtaaatgat      6240
     catgatacat caactgtgga tagtaatgct atggatgtac ccagtaaagt acaaattgaa      6300
     atggatgtaa atacaaaatt ggtgaaagag aaatatccta taggagatgt atgggatata      6360
     taa                                                                    6363
//

If you have problems or comments...

PBIL Back to PBIL home page