(data stored in ACNUC9543 zone)

EMBL: AL844507.PE100

AL844507.PE100       Location/Qualifiers
FT   CDS_pept        complement(join(534469..534510,534685..534786,
FT                   534913..535063,535169..535301,535496..535603,
FT                   535773..535836,535992..536139,536266..536392,
FT                   536583..536619))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0810500"
FT                   /product="protein phosphatase PPM7, putative"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0810500"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.108:mRNA"
FT                   /db_xref="GOA:Q8IAU0"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAU0"
FT                   /protein_id="CAD51270.1"
FT                   /translation="MPVINGAHVISMKNYTLVSDAYGEKGVKKVYEDEYLICENLKSFN
FT                   KNLHPNFNFACFCLFDGHNGKNTAMFLKRNLAQELSNSFLEMQNTYDSSLPIPDHFIKI
FT                   SVNNTCKRIDERIAQEYPNSRDGATCVIVLIKDEYAYIINIGDSCAYLCRYLNNSNQAI
FT                   ELVDIHKPWVITEKERIIKHGGTIENGRVNDIIDVTRSFGDLSLKKYGLLCTGTFKKFK
FT                   INSDDNFIILGTDGFFGSVDINYVINEITNLSKKEERLVNVEKKKTVFDAKSICNIMVE
FT                   HAIVDKKSQDNVTVVLIKFLHK"
     atgcctgtaa taaatggagc acatgttatt tctatgaaaa attatacttt agttagtgat        60
     gcatatggtg aaaagggagt aaagaaagtt tatgaagatg aatatttgat atgtgaaaat       120
     ttaaaaagtt ttaataaaaa cttacatcct aatttcaact ttgcttgttt ttgtttattt       180
     gatgggcata atgggaaaaa tacagccatg tttttaaaaa gaaatttggc acaagagtta       240
     tcaaatagtt tcttagaaat gcagaataca tatgattcgt ctcttcccat acctgatcat       300
     tttataaaaa taagtgttaa taatacatgt aaaaggattg atgaaaggat agcccaagaa       360
     tatccaaata gccgagacgg tgccacgtgt gtgatagttt taataaagga tgaatatgct       420
     tatataataa acataggaga ttcgtgtgca tatttgtgtc gatatttaaa taattctaat       480
     caggccattg aattagtaga tattcataaa ccttgggtta taacagaaaa ggaaagaata       540
     ataaaacatg gaggcactat tgaaaatgga agagtgaacg atataatcga tgtcacaaga       600
     tcttttggag acttatcatt aaagaaatat ggcttattgt gcacggggac gtttaaaaag       660
     tttaaaataa attctgacga taattttata attctgggaa cagatggatt ttttggttct       720
     gttgatatca attatgtgat aaatgaaata acaaatttgt ctaaaaagga agaacgattg       780
     gtaaacgttg aaaaaaaaaa gacagtattc gatgctaaga gtatttgcaa tattatggtg       840
     gaacatgcta ttgttgataa aaaatctcaa gataatgtaa cggttgtttt aatcaaattt       900
     ctgcacaaat aa                                                           912
//

If you have problems or comments...

PBIL Back to PBIL home page