(data stored in ACNUC9543 zone)

EMBL: AL844507.PE102

AL844507.PE102       Location/Qualifiers
FT   CDS_pept        complement(join(546163..546217,546312..546432,
FT                   546577..546608,546827..546878,546978..547063,
FT                   547286..547365))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0810700"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0810700"
FT                   /db_xref="GOA:A0A143ZWS9"
FT                   /db_xref="UniProtKB/TrEMBL:A0A143ZWS9"
FT                   /protein_id="CZT62752.1"
FT                   /translation="MDIVYDWYNSLCCYKTIHKINNYVKVNREILNSQEKEIVYENKYV
FT                   PHTIAVLLALGIQTSFHNMKRLKVFRFRPYLPISFGIITSCSFLYVHNLYMSRKTISKL
FT                   IHLYLMSSNERGVSNKIDQIYKTEEPSDYLYLTRNIS"
     atggatatag tttatgattg gtataattca ttatgttgtt ataagaccat acataaaatt        60
     aataattacg taaaagtaaa tagagagata ttaaattctc aggaaaaaga aattgtgtat       120
     gagaataaat atgtacctca tacgatagct gttctactag ctcttggaat tcaaacatct       180
     tttcataata tgaagagact gaaagttttt cgttttagac catatcttcc aatatctttt       240
     ggaataataa catcttgttc atttttatat gtgcataacc tatatatgag tcgcaaaact       300
     attagtaaat taattcacct atatttaatg tcctcaaacg aaaggggagt atccaataaa       360
     atcgatcaaa tatataaaac agaagaacct agtgattatt tatatttaac aagaaatatt       420
     tcatga                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page