(data stored in ACNUC9543 zone)

EMBL: AL844507.PE104

AL844507.PE104       Location/Qualifiers
FT   CDS_pept        complement(join(551199..551903,552096..552428))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0810900.1"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0810900.1"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.106.1"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAU4"
FT                   /protein_id="CAD51266.1"
FT                   /translation="MSETSACPLNDFFDIDEENNLDEIKKEEKDVFSGNFLSYIYNQFE
FT                   FCCINFFDELKKKDKRKNITLKKNYSDGYSKNDNGQCYYNVFDKILKKDVDTIKEVSLH
FT                   SIYFNPHADWCECAHEFNLELNHEEAEFCIFNFFLKMYRYEERNKDLLLSILLECLYSK
FT                   KDMKKAFHIQKENLKFLKEIKNIETSNFKESLNELINIIENTNFIQFNANEKKDMQKYY
FT                   FKLYIIIKIKYPYGIYIFNCDDVYDIVVIDCNTFMQNKPKIMSFLSLRKFISFLNNIYS
FT                   ININEENIYDSFPIIVYESKECYHLSHSHLPLNLTACTPKEKKKNSVKNHLNQSGNENE
FT                   NENKD"
     atgtcagaaa cttcagcttg tccactaaac gatttttttg atatagatga agaaaataat        60
     ttagatgaaa taaaaaaaga agaaaaagac gtatttagtg gaaacttttt atcttatata       120
     tataatcaat ttgaattttg ttgtataaat ttttttgatg aattaaagaa aaaggataaa       180
     agaaaaaata taacattaaa aaaaaattat tcagatggtt atagtaaaaa tgataatggt       240
     caatgttatt ataatgtgtt cgataaaatt cttaaaaaag atgtagatac tattaaggag       300
     gtttcccttc actccatcta ttttaacccc cacgcagact ggtgtgaatg cgcacacgaa       360
     tttaacctag aactaaacca tgaggaagcc gaattttgta ttttcaactt cttcttaaaa       420
     atgtacagat atgaagaaag aaataaagat ttactacttt ccatactttt ggaatgttta       480
     tattctaaga aagatatgaa aaaagcattt catatacaaa aagaaaattt aaaattttta       540
     aaagaaataa aaaatataga gacaagtaat tttaaagaat ctttaaatga attaattaat       600
     attattgaga atacaaattt tatacaattt aatgcgaatg aaaaaaaaga tatgcaaaaa       660
     tattatttca aattatatat cataataaaa attaaatatc catatggtat atatatattt       720
     aattgtgatg atgtatatga tatagttgta atcgattgta atacatttat gcaaaataaa       780
     ccaaaaataa tgagttttct ttctcttcga aaatttattt catttcttaa taatatatat       840
     tcaattaata ttaatgagga aaatatatat gattcctttc ctataattgt ctatgaatca       900
     aaagaatgtt atcatttatc tcatagtcat ttacctctta atttgactgc atgtacaccg       960
     aaggaaaaaa aaaagaattc cgtaaaaaat catttgaacc agtcaggaaa tgaaaatgaa      1020
     aatgaaaata aggactga                                                    1038
//

If you have problems or comments...

PBIL Back to PBIL home page