(data stored in SCRATCH zone)

EMBL: AL844507.PE105

AL844507.PE105       Location/Qualifiers
FT   CDS_pept        complement(join(551867..551899,552096..552428))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0810900.2"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0810900.2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A146M1X1"
FT                   /protein_id="CZT62753.1"
FT                   /translation="MSETSACPLNDFFDIDEENNLDEIKKEEKDVFSGNFLSYIYNQFE
FT                   FCCINFFDELKKKDKRKNITLKKNYSDGYSKNDNGQCYYNVFDKILKKDVDTIKEVSLH
FT                   SIYFNPHTGVNAHTNLT"
     atgtcagaaa cttcagcttg tccactaaac gatttttttg atatagatga agaaaataat        60
     ttagatgaaa taaaaaaaga agaaaaagac gtatttagtg gaaacttttt atcttatata       120
     tataatcaat ttgaattttg ttgtataaat ttttttgatg aattaaagaa aaaggataaa       180
     agaaaaaata taacattaaa aaaaaattat tcagatggtt atagtaaaaa tgataatggt       240
     caatgttatt ataatgtgtt cgataaaatt cttaaaaaag atgtagatac tattaaggag       300
     gtttcccttc actccatcta ttttaacccc cacactggtg tgaatgcgca cacgaattta       360
     acctag                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page