(data stored in ACNUC9543 zone)

EMBL: AL844507.PE107

AL844507.PE107       Location/Qualifiers
FT   CDS_pept        complement(557884..559506)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0811100"
FT                   /product="mitochondrial carrier protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0811100"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0093:mRNA"
FT                   /db_xref="GOA:Q8IAU6"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAU6"
FT                   /protein_id="CAD51264.1"
FT                   /translation="MDIKNEGYNIVNNLMNYLKIGQKNDENKCPNYNIEENGDAKIVKT
FT                   RTLNFIISSAVVLCVLHPLDTIRTRKQIYRVYKNSYPYYYNNKYSLLYILKKEKFESIY
FT                   RGLLASLITTGVSQGTFRFIYDTLNYYIIQNFNNNNNINDNNKITNEINNIGNEKYIIY
FT                   NNINQNNNNNNNNKNENNINMNYYILTSSISSIISVLFLHPIWLIKTKIECTINLNYKF
FT                   INYKSRILSKHYKIFSPRNKIFNYKMIYNIISLFIINPKNKIHGNYKKVRYINNNLMKT
FT                   YKNNFIYNKHIKSVYKYNHLSYIKTNHMCSNKTLQKKMIHNYTLYKYYALSNFERKHLT
FT                   KKCLSTFRKKFRNKHILYSKRPLSGNEILHIFKREENKNNVSAVYKYKNYFHFVYSIYK
FT                   KEKLFSFYKGFLASLLLTPHVALQFYTYEYLTHFFSSQYINNILQNKNIHFSSDVLNKF
FT                   LPFLYGALSKYIAIIFTYPLYTIKMRQQVQMKNYGFYKVLLNIFKCEGIRSYYTGINMH
FT                   LLRNCLQNGILFFIFEYLNNAKI"
     atggacataa aaaatgaagg ttataatatt gtaaataatt taatgaatta tttgaagata        60
     ggtcaaaaaa atgatgagaa taaatgtcca aattataata ttgaagaaaa tggtgatgca       120
     aaaattgtaa agacaagaac attaaatttt ataatatctt cggctgttgt tttatgtgta       180
     ttacatccac tggacacaat aaggacacgt aaacaaatat atcgagttta taaaaattca       240
     tatccatatt attataataa caaatatagt ttattgtata tactgaaaaa agaaaaattc       300
     gaaagcatat atcgtggatt gctagcaagt ttaattacta ccggagtatc tcaaggtacc       360
     tttcgattta tttatgacac cttaaattat tatataattc aaaattttaa taataataat       420
     aatattaatg ataacaataa aataacgaat gaaataaata atataggaaa tgaaaaatat       480
     attatataca ataatattaa tcaaaataat aataataata ataataataa aaatgaaaat       540
     aatataaata tgaattatta tattctaacc agtagtataa gctcaattat aagtgttctt       600
     ttccttcatc ccatatggct tattaaaacc aagatagaat gtacaataaa tttaaattat       660
     aaatttataa attataaaag tagaatatta agtaaacatt ataaaatctt ttctccaaga       720
     aataaaatat ttaattataa aatgatatat aatataatat ccctatttat tataaatcca       780
     aaaaataaaa tacatggtaa ctataaaaaa gtaagatata ttaataataa tttgatgaag       840
     acatataaaa ataattttat atataacaaa catattaaat cagtttataa atataatcat       900
     ctttcttaca taaaaacgaa tcatatgtgt tcaaataaaa ctttacaaaa aaaaatgata       960
     cataattata cattatataa atattatgca ttgtctaatt ttgaaagaaa acatttaaca      1020
     aagaaatgtt tatcaacatt tcgaaaaaaa tttcgtaata aacatatttt atattcaaaa      1080
     agacctttat caggaaatga aatattacat atattcaaaa gagaagaaaa taaaaataat      1140
     gtaagtgctg tttataaata taagaattat tttcattttg tttatagtat atataaaaaa      1200
     gaaaagctgt tttcttttta taaaggattt ttagcatctt tattattaac accacatgta      1260
     gcattacaat tttatacata tgaatatttg acacattttt ttagttcaca atatataaat      1320
     aatatcttac aaaataaaaa tatacatttt tcatcagatg tcttaaataa attcttacct      1380
     tttctatatg gagccttatc caaatatatt gcaatcattt ttacgtatcc attatatacc      1440
     attaaaatga gacaacaagt tcaaatgaaa aattatggtt tttataaagt gttacttaat      1500
     atctttaaat gtgaaggtat ccgatcatat tatactggta ttaatatgca cttattaaga      1560
     aattgtttac aaaatggtat actctttttt atatttgaat atttgaataa tgcaaaaatt      1620
     tga                                                                    1623
//

If you have problems or comments...

PBIL Back to PBIL home page