(data stored in ACNUC9543 zone)

EMBL: AL844507.PE11

AL844507.PE11        Location/Qualifiers
FT   CDS_pept        complement(join(84568..88029,88225..88422))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0801000"
FT                   /product="Plasmodium exported protein (PHISTc), unknown
FT                   function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0801000"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0137:mRNA"
FT                   /db_xref="GOA:Q8IAK9"
FT                   /db_xref="InterPro:IPR006526"
FT                   /db_xref="InterPro:IPR019111"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAK9"
FT                   /protein_id="CAD51354.1"
FT                   /translation="MIFVKSKILYFLKWPSVAIEENFSGSFKCLFKNKRNKYVRNNLSR
FT                   FILSVSLILFFFHFVLCSTIENVEILKNDYNTLTESHNIINRRSRNLGANPESISLGYE
FT                   LSEKDEGNKNDLINSATDVSTELENLKERLFPELELYTNDQNSRNNTPNLRKGSLGFDS
FT                   FKKLELGTLNQFDKDKMINLKDETNMNEFEGFLGRNSMASNVVTSELFDEPVDDSSSTT
FT                   TSTGTKLQNVPSNDNNGELLKDEPIDDYINNNSKVESEDNYYAQQNMQSQSKDNYASEQ
FT                   NVADQSTDNYPTQHDVPVQLRDNYASEQEYFDRGEQLNDVSADNNTSNKLKDEPVDNNT
FT                   SNKLKDEPVDNNTSNKLKDEPVDDNTSNKLKDEPVDNNTINKLKDEPVDDNTSNILKDE
FT                   PVDDHAGKHLKDEPVDDHAGKHMKDEPVDIDRTNIKKGLNEQHVNPWTTTLADLKNINN
FT                   SMKIEKNNKSNEQVKNTSVSKSCDIIKPSKFNKKNLFEQRLQSVEGKNFFEGRSQNLEG
FT                   RSNFDERSQIVEQRRNFDDRDQNIMDRKNFDERNQQVNDRRNFDERNQQVNDRRNFDDR
FT                   DQNVMDRRNFDERNQQVNDRRNFDERNQQVNDRRNFDDRDQNVMDRRNFDERNQQVNDR
FT                   RNFDERNQQVNDRRNFDDRDQNVMDRRNFDERNQQVNDRRNFDERNQQVNDRRNFDERN
FT                   QHVNDRRNFDERNQNVNDRRNFDERNQNVNDRRNFDERNQQVNDRRNFDERYQNVNERR
FT                   NFDERNQQVNDRRNFDERNQHVNERYQNVNDRRNFDERNQQVNDRRNFDERNQHVNERR
FT                   NFDERNQHVNERYQNVNDRRNFDERNQHVNERRNFDQRAPNVEERRYMDPRNPNIPYVR
FT                   FPHHQWGQGMMYGRPYYPWVPFMGDGRGYNFYNPHQHMVYGRPYYWVPPPPALEYTKGF
FT                   NPMEQRREEDRGHMGGRGSRYPEEERYNYNNKRSNSIPEGRNYEENAYERGGGNNKWDF
FT                   RNMYDRLRDEDENDYDQPPSTSSSNRGRGNERYSQSRDRREERNNYNSDYYTRGNERTY
FT                   NNSNVTSSSNRELIPYKKEILPFGVSNSELEDKLTEEELNERIRRLDYTVSVKDMFILW
FT                   NHILAHERKKYTKMQEYLMYYSQYLEKTYLVPTAFRKKYWWRVHYMLTEEVVKRERTDN
FT                   LDFHQFLRKGSCEKREFLYFINSKRKGWADLTETMKNIWMERLTYKMRKYSGA"
     atgatatttg ttaagagtaa gattttatat ttcctaaaat ggccttctgt tgccatagag        60
     gaaaatttta gtggttcctt taaatgttta ttcaaaaaca agaggaataa atatgtaagg       120
     aataatttat caagatttat tctttcagtt tctttaattt tgttcttttt tcattttgtt       180
     ctatgtagca caatagaaaa tgttgaaata ttaaagaatg attataatac gctaacagaa       240
     agtcataata taattaatag aaggtctaga aatttaggag cgaatccaga atccattagt       300
     ttaggttatg aattaagtga aaaggatgaa ggaaataaaa atgatctaat aaatagtgct       360
     acagatgtat caacagaatt agagaattta aaagaacgtt tatttcctga actagaatta       420
     tatacaaacg atcaaaattc aagaaataat actccaaatt tacgtaaggg ttctttggga       480
     tttgatagtt ttaaaaaatt ggaattagga acactaaatc aatttgataa agataaaatg       540
     attaatctga aagatgaaac caatatgaat gaatttgaag gatttctagg aagaaattca       600
     atggctagta atgtagttac atccgaatta tttgatgaac cagtagatga tagtagtagt       660
     actactacta gcacaggtac aaaattgcaa aacgttccat cgaatgataa taacggtgaa       720
     cttttgaaag atgaacctat agatgattat ataaataata attcgaaagt tgaatcggaa       780
     gataattatt atgcacaaca gaatatgcaa agtcagtcga aagataatta tgcttcagaa       840
     caaaatgtag cagatcaatc gacagataat tatcctacgc aacatgatgt accagttcaa       900
     ttgagagaca attatgcttc agaacaagag tattttgata gaggtgaaca attgaatgac       960
     gtaagtgcag ataacaatac aagtaataaa ttgaaagacg aacctgtaga taacaataca      1020
     agtaataaat tgaaagacga acctgtagat aacaatacaa gtaataaatt gaaagacgaa      1080
     cctgtagatg acaatacaag taataaattg aaagacgaac ctgtagataa caatacaatt      1140
     aataaattga aagacgaacc tgtagatgac aatacaagta atattttgaa agacgaacct      1200
     gtagatgacc atgcaggtaa acatttgaaa gatgaacctg tagatgacca tgcaggtaaa      1260
     catatgaaag atgaacccgt tgatattgat agaacaaata ttaaaaaggg tttaaatgaa      1320
     caacatgtta atccatggac tacaacatta gcagatttaa aaaatattaa taatagtatg      1380
     aaaatagaaa aaaataataa aagtaatgaa caggtaaaaa atacgagcgt tagcaaatca      1440
     tgtgatatta taaaaccttc caagtttaat aaaaagaacc tttttgagca aagacttcaa      1500
     agtgttgaag gtaaaaactt ttttgaagga agaagtcaaa atttagaagg aagaagtaat      1560
     tttgatgaga gatctcaaat tgtagaacaa aggagaaact ttgatgacag ggaccagaac      1620
     ataatggata gaaaaaattt tgatgaaaga aatcaacagg ttaatgacag aagaaatttt      1680
     gatgaaagaa atcaacaggt taatgacaga agaaattttg atgacaggga tcagaacgta      1740
     atggatagaa gaaactttga tgaaagaaat caacaggtta atgacagaag aaattttgat      1800
     gaaagaaatc aacaggttaa tgacagaaga aattttgatg acagggatca gaacgtaatg      1860
     gatagaagaa actttgatga aagaaatcaa caggttaatg acagaagaaa ctttgatgaa      1920
     agaaatcaac aggttaatga cagaagaaac tttgatgaca gggatcagaa cgtaatggat      1980
     agaagaaact ttgatgaaag aaatcaacag gttaatgaca gaagaaattt tgatgaaaga      2040
     aatcaacagg ttaatgacag aagaaatttt gatgaaagaa atcaacatgt taatgacaga      2100
     agaaattttg atgaaagaaa tcaaaatgtt aatgatagaa gaaattttga tgaaagaaat      2160
     caaaatgtta atgatagaag aaattttgat gaaagaaatc aacaagttaa tgacagaaga      2220
     aattttgatg aaagatatca aaatgttaat gagagaagaa attttgatga gagaaatcaa      2280
     caagttaatg acagaagaaa ttttgatgag agaaatcaac atgttaatga gagatatcaa      2340
     aatgttaatg atagaagaaa ttttgatgaa agaaatcaac aagttaatga cagaagaaat      2400
     tttgatgaga gaaatcaaca tgttaatgag agaagaaatt ttgatgagag aaatcaacat      2460
     gttaatgaga gatatcaaaa tgttaatgat agaagaaatt ttgatgaaag aaatcaacat      2520
     gttaatgaga gacgaaactt tgatcaaagg gctccaaatg tagaagagcg aagatatatg      2580
     gatccaagaa atccgaatat tccatatgta aggtttccac atcatcagtg gggtcaagga      2640
     atgatgtatg gaagaccata ttatccttgg gttccattta tgggagatgg aagaggttat      2700
     aatttttata atcctcatca acatatggta tatggaagac cctattattg ggtacctcca      2760
     cccccagcgt tagaatatac aaaaggattt aatccaatgg aacagagaag agaagaagac      2820
     aggggacata tgggaggaag aggtagtaga tacccagaag aggaaagata taattataac      2880
     aataagagaa gtaatagtat acctgaagga cgaaattatg aagagaatgc atatgagaga      2940
     ggaggaggga ataataaatg ggattttcga aatatgtatg atagattaag agatgaagat      3000
     gaaaatgatt atgaccaacc tcctagtaca tcttcttcta atagaggaag aggtaatgaa      3060
     agatatagtc aatcaagaga tagaagagaa gaaaggaata attataatag tgattattat      3120
     actagaggaa atgagagaac atataataat tcaaatgtaa caagtagttc aaatagagaa      3180
     ttaatacctt acaaaaaaga gatattacct tttggtgtta gtaattctga attggaagat      3240
     aaattaacag aagaggaatt aaatgaaaga ataagaagat tagattatac agtatctgtt      3300
     aaagatatgt ttatattatg gaatcatata cttgcacatg aaagaaaaaa atatacaaaa      3360
     atgcaagaat atttaatgta ttatagtcaa tatttagaaa aaacatatct tgttcctaca      3420
     gcttttagaa aaaaatactg gtggagggtt cattatatgt tgaccgaaga agtagttaaa      3480
     agagaaagga cagataattt agatttccat caattcttac gtaaaggttc ttgtgaaaaa      3540
     cgtgaatttt tatattttat taattctaaa agaaaaggat gggctgatct tacggaaaca      3600
     atgaaaaata tatggatgga aagattaact tataaaatga gaaaatatag tggagcataa      3660
//

If you have problems or comments...

PBIL Back to PBIL home page