(data stored in ACNUC9543 zone)

EMBL: AL844507.PE112

AL844507.PE112       Location/Qualifiers
FT   CDS_pept        complement(join(582983..586525,586864..586953))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0811600"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0811600"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0091:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAV1"
FT                   /protein_id="CAD51259.1"
FT                   /translation="MNNVIIFLLLLINFGTKVYGDDNGEHSANNINGKEEEVEDRWKMY
FT                   ALETNPFLDLKHPNFNGHFIRSIDEYYVYETKTYNEYMKERYKNLENNNTFTKKQFHCA
FT                   LAVFNHGRPNPKQTNDYKIWSAQGNILLNEVMHKKKYDKFIIYAPFVSLYNFLGKEGIH
FT                   SHINFAYIIVSRLALTIKNALNDDSCHTYDLYLHGHCFGGNIIRIISSLSKDLWKIFQR
FT                   EVINFKIERETLAIIDSNFHLTLKDINIVTDSDSIEVRKDPYFKKDRFYLYKDFKYKES
FT                   NKPISETFDDVFDDADIGYHRLKDLDNPENTNNAHQVSDEDDNLLRPIKRLHFYLLNKK
FT                   INLHSITVTGPPLSGTFSKMEDINVGHQGFFKQKYIVKYLPYYLKRATMHKFRDVEEVL
FT                   LIYNSELFCLLTVHEKFSYDYTNNLGSLMTFFKSVNFYSDLDNDEIVSMHASLALHSPL
FT                   HMRSLTYYLLNFRNEYYHRAFRIPSHLSDINVSNNYPFFEYLKNNNVCSSMSSRHIEQF
FT                   ISYVNEAINFNQKPKPLIPQRVIYKNPYLEHFVLPYIPDKSIYTPHTILGTGRTYLLLY
FT                   TFDIYKHIAGSAFSNANVLTNDKELLYDSDPFIYYNWTSHVGDQNNVQTNYFMQDIYVF
FT                   SDNVNMNIVDNLFNIFTSTHLVKFFIFNKNHSADVYKSLYRTVEKFALPMVDIVLRKQR
FT                   KKYIEYPFLKNDKFNDEENLVYEYINNYTNYLKNFSFNNSKVYISNDNFITNHETFKKY
FT                   HTEGINTLKEQLSSLHKFAQENKTFYEMKKKFESMHNMNKINSSNNESFNEKELQEMYE
FT                   EYDDFNNIEKPTQDETDNSNEENKSKLDVNYHGIYLLIKRTLSLKEAFQSLKSYNSSYY
FT                   NVKYIEFIIKNSYLEHVDDNISNIDDVSSCLFNHDDDISLGYIAKYCNYNQRLYFNIKK
FT                   HYISRDIFTVPKLKYCEKPKYKHLKICENVILLKFYFRSDLETLLSNLNNKELKRMTEM
FT                   KESVEAGIGKENIFSLTNDSLVTLFHHRNDDITNLPVNACFKLSSISNMNDFFFKKNNV
FT                   ENSSSTKNNGNNLSENIFCTQVTLPVILNKLTIKSINDIYLRAISNVMKYKEFKNIFQL
FT                   SEDEEPYDSFVYFFDKFTYIYNVRTFYQNYNEIETFSTPQNLKWNYFYYLLKNGLNTDY
FT                   NNENFLQNFFYGEHANLVKPLRENILKSFLKHFTVFFYLFKVDE"
     atgaataatg tcataatatt tttattatta cttattaatt ttggcacaaa agtatatggt        60
     gatgataatg gcgaacacag tgcgaataat attaatggaa aagaggaaga agttgaagat       120
     agatggaaaa tgtacgcctt agaaacaaac ccatttcttg atttaaaaca cccaaatttc       180
     aatggtcatt ttataagaag tatagatgaa tattatgtat atgaaactaa aacatataat       240
     gaatatatga aagagagata taaaaatttg gagaacaata atacttttac aaaaaagcaa       300
     tttcattgtg cacttgctgt atttaatcat ggtcgtccta atcctaaaca aactaatgat       360
     tataaaatat ggagtgctca aggaaatatt ttattaaatg aagttatgca caaaaaaaag       420
     tatgataaat ttataatata tgctccattt gttagtcttt ataacttttt aggaaaagaa       480
     ggtattcatt ctcatataaa ctttgcttat attattgtaa gtagattagc attaacaatt       540
     aagaatgcat taaatgatga ttcatgtcat acgtatgatt tatatttaca tggacattgt       600
     tttggtggaa atattattag aataatatca tccttaagta aagatttatg gaaaatattt       660
     caaagagaag ttattaattt taaaattgaa cgtgaaaccc tagctattat tgattctaat       720
     ttccacttaa cattaaaaga tataaatatt gtaactgata gtgattcgat tgaagtacgt       780
     aaagatccat attttaagaa agatagattt tatttatata aagattttaa atataaagaa       840
     tcaaacaagc caatatcaga aacttttgat gatgtgtttg atgatgcaga tataggttat       900
     catcgtttaa aagatttaga taatcctgag aatactaata atgctcatca agtatcagat       960
     gaagatgata atttacttag accaataaag agattacatt tttatctttt aaataaaaaa      1020
     attaaccttc atagtataac tgttactggt cctccgttaa gtggaacctt ttccaaaatg      1080
     gaagatatta atgttggtca tcaaggtttt tttaaacaaa aatatattgt aaaatatttg      1140
     ccttattatc ttaaaagagc tacaatgcat aaatttagag atgtagaaga agttttactt      1200
     atatataatt cagaattatt ttgtttatta accgtacatg aaaagttttc atacgattat      1260
     actaataatt taggttccct tatgacattt tttaaaagtg taaactttta ttctgattta      1320
     gataatgatg aaatagttag tatgcatgct agtcttgctt tacattctcc actacatatg      1380
     agatcattaa cttattatct attaaatttt agaaatgagt attaccatcg tgcttttaga      1440
     ataccatcac atttatcaga tattaatgtt tctaacaatt atcctttttt tgagtatcta      1500
     aaaaataata atgtatgttc ttccatgtca tccagacata tagagcaatt tatttcatat      1560
     gttaatgaag caattaattt taatcaaaaa ccaaaacccc ttataccaca aagagttata      1620
     tataagaatc cgtatttaga gcattttgtt cttccatata ttcctgacaa aagtatatat      1680
     actccacata ctatattagg tacaggtaga acatatttat tattatatac ttttgatata      1740
     tataaacata ttgctggatc tgcatttagt aatgctaatg ttttaactaa tgacaaagaa      1800
     ttattatatg attcggatcc atttatttat tataattgga caagtcatgt tggagatcag      1860
     aacaatgtac aaacaaatta tttcatgcaa gatatttatg tattttcgga taatgttaat      1920
     atgaatatcg tagacaattt gtttaatata tttacctcaa cacatcttgt aaaattcttt      1980
     atattcaata aaaatcatag tgcagatgta tataagagtt tatatagaac tgttgagaaa      2040
     tttgcattac caatggttga tatagtttta agaaaacaaa gaaagaaata tatagagtat      2100
     ccatttttaa aaaatgacaa atttaatgat gaagaaaatt tagtatatga atatataaat      2160
     aattatacca actatttaaa aaatttcagt tttaataatt ccaaagttta tatatcaaat      2220
     gacaatttta ttacaaatca tgaaacattc aaaaaatatc atacagaagg tattaataca      2280
     ttgaaagaac aattatcaag tttacataaa tttgctcaag aaaataaaac tttttatgaa      2340
     atgaaaaaga aatttgagtc tatgcataat atgaataaaa taaatagttc gaataatgaa      2400
     tcatttaatg aaaaagaact acaagaaatg tatgaagaat atgatgattt taataatatt      2460
     gaaaaaccaa cacaagatga aactgataac agtaatgaag aaaataaatc aaaattagat      2520
     gtaaattatc atggtattta tttactaata aaaagaaccc taagtttaaa agaagctttt      2580
     caatctttaa aatcatataa ttcctcatat tataatgtca aatatatcga atttataata      2640
     aaaaattctt atttagaaca tgttgacgat aatataagta atatagatga tgtaagttct      2700
     tgtttattta atcatgatga tgatattagt cttggttata ttgctaaata ttgtaactat      2760
     aatcaacgtc tttatttcaa tattaaaaaa cattatatat caagggatat atttaccgta      2820
     cctaaattaa aatattgtga aaagccaaaa tataaacatt taaaaatatg tgaaaatgtt      2880
     attctactaa aattttattt ccgtagtgat cttgaaaccc ttttatctaa tcttaataac      2940
     aaagaattaa aaagaatgac agaaatgaaa gaatcagtag aagcaggtat aggtaaagag      3000
     aatatctttt ctttaacgaa tgattcatta gttactttgt ttcatcatag aaatgatgat      3060
     ataacgaatc tacctgtaaa tgcttgtttc aaattatcaa gtatttcaaa tatgaatgat      3120
     ttctttttca aaaaaaataa tgttgaaaat agtagtagta caaagaacaa tggtaataat      3180
     ttaagtgaga acatattctg tacacaagtc actctacctg ttatattaaa taaactaacc      3240
     attaaaagta ttaatgatat atatttaaga gccattagta atgttatgaa atataaggaa      3300
     tttaaaaaca tcttccaatt atcagaagat gaagaaccat atgattcatt cgtatatttc      3360
     ttcgacaaat ttacttatat ttataatgtc agaacgtttt atcaaaatta taatgaaatt      3420
     gaaacattta gtacaccaca aaatttaaaa tggaattatt tctattactt gttaaaaaat      3480
     ggattaaata cagattataa taatgaaaac tttttacaaa atttctttta tggagaacat      3540
     gctaatctag tcaaaccatt aagagaaaac attttaaaga gtttcttaaa acatttcacc      3600
     gtcttctttt atttatttaa ggtagacgaa taa                                   3633
//

If you have problems or comments...

PBIL Back to PBIL home page