(data stored in ACNUC9543 zone)

EMBL: AL844507.PE114

AL844507.PE114       Location/Qualifiers
FT   CDS_pept        complement(593649..595412)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0811800"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0811800"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.102:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAV3"
FT                   /protein_id="CAD51257.1"
FT                   /translation="MIRKRLQYLKKDYLKYQYRNIISSSIKKRKQNYKGESLNLYVAFN
FT                   YNINLCHERFDKNIYLYDVNSTIFKLSKYIHKFKKYIKNQTTKKKGYEKNDKYNYKIEQ
FT                   LFMCYISLHNNINRYIFLRLTRDVLNFPPLKEKIINDKKYYEYLLYEIIKCGQENKVDK
FT                   IHFYEYVIKIISSFLLNSTLFFNELFEREFFLDFLNLIKKEDINNYINNFTYLLSCISL
FT                   YKRTLKKNNTFHNNKDIILSSKFLSENNSNILIEKKKMELLLDSLHIILQIFDKIQNYH
FT                   YFKQIDICNIFDFLNEFKSFHKIKICILINIHKYLIPSSDMKHLCLLLYLITSNKNNNN
FT                   NKNNRNICNEYIQQNAYKYIYNIIFLRRNELYDIKNWNLFLLSLIKYKKNERTNKIMRK
FT                   GKIKNVKMIKINEKINDKINEKKNGHINEKINDKINDKINDKINDKINEKIYEKINRHT
FT                   NKISLVLINGETNKTTNMSSRSPKKRNYIKYNKKFELCLNVKNSYMNKKKKYKERILYF
FT                   SIKNYFMQLIEQEKKKIINPKYIKTFYEYFSFYHIKKNCIRKKNYISPLVLIQNYESEK
FT                   EKQKKKKNNIC"
     atgataagga aaaggctaca atatttaaag aaagattatt taaaatatca atatagaaat        60
     attatatcat caagtattaa aaagagaaaa cagaattata aaggagaaag tttaaattta       120
     tatgtagctt tcaattataa tataaatttg tgtcatgaac gatttgacaa gaatatttat       180
     ttgtatgatg tgaactctac catttttaaa ctttccaaat atatccataa attcaagaaa       240
     tatataaaaa atcaaacaac caaaaagaag ggatatgaaa agaatgataa atacaattat       300
     aaaatagaac aattatttat gtgttatatt tcacttcata acaatattaa tagatatata       360
     tttttaagat taacaagaga tgttttaaat ttcccacctt taaaagaaaa aataattaat       420
     gacaaaaaat attatgaata tcttttatat gaaataataa aatgtggaca agaaaataaa       480
     gttgataaaa tacattttta tgaatatgta ataaaaatca tttcaagttt cttattgaat       540
     tctactttat ttttcaatga actttttgaa agggaatttt ttttagattt cttaaattta       600
     attaaaaaag aagatattaa taattatatc aataatttta catatctgct ttcatgtatt       660
     tcattatata aaagaacact gaagaaaaat aatacttttc ataacaataa ggatataata       720
     ttatcatcta agtttttatc tgaaaataat tcaaatatat tgatagaaaa aaagaagatg       780
     gaactattac tagatagctt acatattata ttacaaattt ttgataaaat acaaaattac       840
     cattatttta aacaaataga tatatgtaat atatttgatt ttttaaatga atttaaatca       900
     tttcataaaa taaaaatatg tattcttata aatattcata aatatttgat tccctcaagt       960
     gacatgaaac acttgtgttt attattgtat ttaataacct caaataagaa taataataat      1020
     aataaaaata atagaaatat atgtaatgag tatatacaac aaaacgccta caaatacata      1080
     tacaatatta tttttctaag aagaaatgaa ctatatgata ttaaaaattg gaacctcttt      1140
     ttattaagct taataaaata taaaaaaaat gaacgcacca ataaaattat gagaaagggc      1200
     aaaatcaaaa atgtaaaaat gataaaaata aatgaaaaaa taaatgataa aataaatgaa      1260
     aaaaaaaatg gacacataaa tgaaaaaata aatgataaaa taaatgataa aataaatgat      1320
     aaaataaatg ataaaataaa tgaaaaaata tatgaaaaaa taaataggca cacaaataaa      1380
     ataagtcttg ttttaattaa tggtgaaaca aataaaacta caaatatgtc ttcaagatca      1440
     ccaaaaaaaa gaaattatat aaaatacaat aaaaagtttg aattgtgctt aaatgttaaa      1500
     aatagttata tgaataaaaa aaaaaagtac aaagagagaa ttttatattt ttcaatcaag      1560
     aattatttta tgcaattaat agagcaagaa aaaaaaaaaa taataaatcc taaatatata      1620
     aaaacatttt atgaatattt ttctttttat catataaaaa aaaattgtat aagaaaaaaa      1680
     aattatatat caccactagt tttaattcaa aattatgaaa gtgaaaaaga aaaacaaaaa      1740
     aaaaaaaaga ataatatatg ttag                                             1764
//

If you have problems or comments...

PBIL Back to PBIL home page