(data stored in ACNUC9543 zone)

EMBL: AL844507.PE115

AL844507.PE115       Location/Qualifiers
FT   CDS_pept        join(596190..596279,596438..596587,596715..599725,
FT                   599817..599884,600017..600140,600241..600328)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0811900"
FT                   /product="RNA-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0811900"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.101:mRNA"
FT                   /db_xref="GOA:C0H4U1"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004170"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4U1"
FT                   /protein_id="CAX64117.1"
FT                   /translation="MLFTKIYLLFVFVLYLVSAFIKRQWVPNNYIYFKTDTYYKRRKKK
FT                   MLEFRVKNHKDNDIDPYIPYIYKDIAPVLKEYADDEYSYKQLVNAYFPETIEREKKIKT
FT                   EGKKYFTNLKKIEEQKKLLEDSKEKSDDASEKIDGAIKKSDKSINKSDKDNKKLNSIED
FT                   VEKAMHEKLIKNDVSNFEHISDIKDHKKKNKILDDTYDIIEDSLKDIYMNSNVNKEEDT
FT                   NNINYIELAKKEKNMLYDKLINNHSIVSDSNTFDLFGVFYDNKNYKDEKKLVAEMDKII
FT                   NLEPFKSNNDSNLLEIIDTILKKNKIPIHVRNFLIKYRDIAKKISDANEKKNKTQSTSE
FT                   GNDYTDNDINIFNTNDKEKDEKYKEFLKDLNKVIMSIHNNLNNEKLLKREYNFLDELYE
FT                   DYKHHLKKMHIKRNRLEPQRNNYDFLTFLHEHYEKYYFLKYGQFDYNFNEKINEIKKKI
FT                   EKDDQKKKQELDVQPITHKDTINENKNDDNDDNNIHNNKIHSDNKNNVNNDNINDEVSI
FT                   HTFEPKMSSAHINNNIKNNKNESVNQIKESKKLKKHILIDMIRNYEKQMYDIYKPDNSI
FT                   TNAYGFNNYIDNEKYDKEINLTLNKFSILNYDSKEEPKVYEKLYVGKLIFGEIFKIEND
FT                   FAYVDINYSCYAEIHVDQLPYNISNIREVFKKKDKLIFEIYKMYPGKILLTLKNIQKIN
FT                   DLNKILLYKTQGTPFDVKVIAILKNGVTVIYNDITSFIHISALSCKYKIKTEQEELEEK
FT                   INEDLLLNKKIKVFCTDINKLNFSNLIYEQNEQLKNLNVYDVLEVDIIHISKYGLMVKY
FT                   FDVVGLIHVSEISKKKVDNLNDYFKINDKLKGVIVNIDYDNKRFSMSTKILERDGKNII
FT                   DHASKIYSDIPNIISDIKKRNTNLKMHDTNIKNQLLSLIDIYKSDKEKKKDVPTNDDNK
FT                   NATVQMDVNMKEGLSQIKEHKELTTHGDNKENIKDMNSKEDKTSSSNNNNNNNNNKNDY
FT                   DEDPEGSSVITKKDIKKDSPTIENNMDLKKIKPNDEHMCNKNELDIYEDEDEDEEDITD
FT                   DEENSKLSIDIHNQMIPYLLMKQQQNKKEDQVEEKGEIVWNLEDDDFLNSNSPTQSSQF
FT                   TEYQWSYLNDKKWINFSYYINRIMNYYFHIHDDYFTYKEKNVTYEINFSKNIRLDIGTG
FT                   LYNRIRKIKK"
     atgttattta cgaagattta tttgttgttt gtattcgtcc tgtaccttgt ttctgctttt        60
     ataaaacgtc aatgggttcc taataattac atatacttta agacagatac gtattataaa       120
     aggagaaaaa agaagatgct agaatttcgt gttaaaaacc ataaggataa tgatattgat       180
     ccttacatac catatattta taaggacata gcacctgtcc taaaggaata tgccgatgat       240
     gaatattcat acaaacaact agtgaatgca tactttccag aaacaataga acgggaaaag       300
     aaaatcaaaa ctgaaggcaa aaaatatttt acaaatttga aaaaaatcga agagcaaaaa       360
     aaattattag aggattcaaa agaaaaatct gatgatgcaa gtgaaaaaat agatggtgcc       420
     attaaaaagt cagataaatc aattaacaaa tcagataagg acaataaaaa attaaattcc       480
     attgaagatg ttgaaaaggc catgcatgaa aaattgataa aaaacgacgt aagcaatttt       540
     gagcatatca gtgatattaa agaccataaa aagaaaaaca aaatattaga tgatacatat       600
     gacattattg aagattcatt aaaagatatt tatatgaatt caaatgtaaa taaagaagaa       660
     gatactaata atataaatta catcgagtta gccaaaaagg aaaaaaatat gttatatgac       720
     aaattaatta ataatcattc tatagtaagt gatagcaata catttgattt atttggagta       780
     ttttatgaca ataaaaatta taaagatgaa aaaaaattgg ttgcggaaat ggataaaata       840
     attaatttag aacctttcaa aagtaataat gatagtaatt tattagaaat tattgatact       900
     attttaaaaa aaaataagat tcctatacat gttcgtaatt ttttgatcaa gtatagagat       960
     attgcaaaaa aaatttctga tgcaaatgaa aaaaaaaata aaacacaatc aacatctgaa      1020
     ggaaatgatt atacagataa cgatataaac atttttaata caaacgataa agaaaaagat      1080
     gaaaaatata aagaatttct aaaggattta aataaagtta ttatgagtat acataataat      1140
     ttaaataatg agaaattatt aaaaagagaa tataattttc tagatgaatt atatgaagac      1200
     tataaacacc atcttaaaaa aatgcacatt aagagaaata gattagaacc acaaagaaat      1260
     aattatgatt ttttaacatt cttacatgaa cattatgaaa aatattattt tttaaaatat      1320
     ggacaatttg attataattt taatgaaaaa ataaatgaaa taaaaaagaa aattgaaaag      1380
     gatgaccaaa aaaaaaaaca agaattagat gtacagccaa taacacataa agatacaata      1440
     aatgaaaata aaaatgatga taacgatgat aataatattc ataataataa aattcacagt      1500
     gataataaaa acaatgtaaa taacgataat ataaatgatg aagtgtctat tcatacattt      1560
     gaaccaaaaa tgagttccgc tcatattaat aataatataa aaaataataa aaatgagagt      1620
     gtcaatcaaa taaaggaatc taagaaatta aagaaacata tactaataga tatgatacgt      1680
     aattatgaaa aacaaatgta tgatatatat aaacctgata attcaataac aaatgcctat      1740
     ggttttaata attatattga taatgaaaaa tatgacaaag aaattaattt aactcttaat      1800
     aaatttagta tattaaatta tgatagtaaa gaagaaccaa aggtatatga aaaattatat      1860
     gttggtaaat taatttttgg tgaaattttt aaaatagaaa atgattttgc atatgtagat      1920
     attaattatt cttgttatgc agaaatacat gtagatcaat taccatataa tattagtaac      1980
     attagagaag tttttaaaaa gaaagataaa ttaattttcg agatatataa aatgtatcca      2040
     ggaaaaatat tattaacttt aaaaaatata cagaaaatta atgacttaaa taaaatatta      2100
     ttatataaaa cacaaggaac accttttgat gtaaaagtaa tcgcaatatt aaaaaatggt      2160
     gtaactgtta tatataatga tattacatca tttatacata tatctgcatt atcatgtaaa      2220
     tataaaataa aaacagaaca agaagaatta gaagaaaaaa ttaatgaaga tcttttatta      2280
     aataaaaaaa taaaagtttt ctgtactgat ataaataaat taaatttctc taatttaata      2340
     tatgaacaaa atgaacagct taaaaatctg aatgtatatg atgtacttga agtagatatt      2400
     atacatattt caaaatatgg tttaatggta aaatatttcg atgttgtagg tttaatacat      2460
     gtatcggaaa tatctaaaaa aaaagttgat aatttaaatg attattttaa aattaatgac      2520
     aaattaaaag gagtcattgt aaatatagat tatgataata agagattttc tatgtccacc      2580
     aaaatattag aaagagatgg gaaaaatatt atagatcatg cctcaaaaat atatagtgat      2640
     attccgaata ttataagtga catcaaaaag agaaacacaa acttgaaaat gcatgataca      2700
     aatattaaaa atcaattgtt atctttaata gatatatata aaagtgataa agaaaaaaag      2760
     aaagatgtgc caactaatga cgataacaaa aacgcgactg tacaaatgga tgtaaatatg      2820
     aaagaagggc tttctcaaat taaggaacat aaagaattga caactcatgg tgataataag      2880
     gagaatatta aagatatgaa cagtaaggaa gataaaacaa gtagtagtaa taataataat      2940
     aataataata ataataaaaa tgattatgat gaagatcctg aaggaagtag tgtaattact      3000
     aagaaggata taaaaaaaga ctcaccaaca atagagaaca atatggattt aaaaaaaatt      3060
     aaaccaaatg atgaacatat gtgtaataaa aatgaattag atatttatga agatgaagac      3120
     gaagatgagg aagacattac agatgatgaa gaaaattcaa aactatccat agacattcat      3180
     aatcagatga ttccttattt attaatgaaa caacaacaaa ataagaagga agatcaagta      3240
     gaagaaaaag gagaaattgt ttggaaccta gaggatgatg attttttaaa ttctaattct      3300
     cccactcaaa gttctcaatt tacggaatat cagtggtctt atttgaatga taaaaagtgg      3360
     ataaacttta gttattatat aaatagaata atgaattatt atttccacat acatgatgac      3420
     tatttcacat ataaagagaa aaatgtaaca tatgagataa atttttccaa aaatataagg      3480
     cttgacattg gcaccggatt atacaataga atacgaaaaa ttaaaaaata a               3531
//

If you have problems or comments...

PBIL Back to PBIL home page