(data stored in ACNUC9543 zone)

EMBL: AL844507.PE116

AL844507.PE116       Location/Qualifiers
FT   CDS_pept        complement(join(600525..600611,600895..602247))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0812000"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0812000"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.100:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAV5"
FT                   /protein_id="CAD51255.1"
FT                   /translation="MILHRVIKSFFSSDLNVSKLLRKKGILFENVKRENCVKDLIVKFM
FT                   ELKGVPINEDDIHIMKNILCRPTGRIMILIDNLKKQNFNFNFDMYEKKEEQNEREHFKD
FT                   KMKTNNIKNGQVIKENEKNKSDNKDIMNITNNNDDDKTNIIYNKEEYYKLKTLFKDCKI
FT                   HLCDDYEIEKFVEECERFLRFTDDIKRISKFENLDKIITIINIPSCYGRKELSEIIYTA
FT                   CNVRIELNNIIFRFKKNGIQSDCAYILCNNIKDANIIIHTIQEYPVAKKYHLTEFYGTA
FT                   FLYASKNNLFISSEKLDYITIFSKYKIFTCGWHKDISIKEFESFLITLKIFPKKIIKIN
FT                   YSKNNILKNNENKPDEHSNDKTLREHICDNNINQLNQTNPNHILINIEEESSSHNDNKS
FT                   KESNEQNDLNTSSFILFFENMRMTKKVFTKFERLKKKWKMSASNNFYAYPKIPDIHFSD
FT                   DIEYMDENEYEDSDLDEEIEY"
     atgatattac atcgagttat aaaatccttt tttagtagtg atttgaatgt ttcaaaattg        60
     ttaagaaaaa agggtatatt gtttgaaaat gtgaaaaggg aaaattgtgt aaaagattta       120
     attgtcaagt ttatggagtt gaaaggagta cccattaatg aggatgacat tcacattatg       180
     aaaaatattt tatgtagacc tacgggtaga attatgatat taattgataa tttaaagaag       240
     caaaacttta attttaattt tgatatgtat gagaagaaag aagaacaaaa tgaaagagaa       300
     cattttaaag ataaaatgaa aacaaataat ataaaaaatg gacaagtaat aaaagaaaat       360
     gaaaagaata aaagtgataa taaagatata atgaatatta caaataataa tgatgatgat       420
     aaaactaata taatttataa taaagaagaa tattataaat taaaaacatt atttaaagat       480
     tgtaaaatac atttatgtga tgattatgaa attgaaaagt ttgtagaaga atgtgaacgt       540
     tttttaagat ttactgatga tataaaaaga atatcaaaat ttgaaaattt agataaaatt       600
     attactatta taaatatacc tagttgttat ggtagaaaag agcttagcga aattatatat       660
     acagcttgta atgtacgtat agaattaaat aatattatat ttagatttaa aaaaaatgga       720
     atacaaagtg attgtgcata tatattatgt aataatatca aagatgcaaa tataattata       780
     cacacaattc aagaatatcc agttgcaaaa aaatatcatc ttacagaatt ttatggaaca       840
     gccttcttat atgcttcaaa aaataattta tttataagtt cagaaaaatt agattatata       900
     accatctttt caaaatataa aatattcaca tgtggatggc ataaagatat atctattaaa       960
     gaatttgaat catttttaat tacactcaaa atatttccaa aaaaaattat taaaatcaat      1020
     tatagtaaga ataatatatt aaaaaataat gaaaataaac cagatgaaca ttccaatgat      1080
     aaaacattaa gggaacatat atgtgataac aatattaatc agttaaatca aacaaatcca      1140
     aatcatattt taattaatat tgaagaagaa tcttcctcac acaatgataa caaaagtaag      1200
     gaatctaatg aacaaaatga tttaaatact tcatcattta ttttattttt tgaaaatatg      1260
     agaatgacta aaaaggtttt tacaaaattt gaaagactaa aaaagaaatg gaaaatgtct      1320
     gcatccaata atttttatgc ataccctaaa attcctgata ttcattttag tgatgatata      1380
     gaatacatgg acgaaaatga atatgaagat tctgacttgg acgaagaaat agaatattaa      1440
//

If you have problems or comments...

PBIL Back to PBIL home page