(data stored in ACNUC9543 zone)

EMBL: AL844507.PE12

AL844507.PE12        Location/Qualifiers
FT   CDS_pept        complement(101954..102826)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0801300"
FT                   /product="von Willebrand factor A domain-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0801300"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0136b:mRNA"
FT                   /db_xref="GOA:Q8IAL0"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAL0"
FT                   /protein_id="CAD51353.1"
FT                   /translation="MKSLKVVLCLGMISACMLVGTYGRMNVVSHNSMKKVGEEGKDEKI
FT                   ISCVVEYVIKGDLSIDDGDFCDSNSICSNNPGLCDNGQVVVPGDYCSNYYDITLVVEES
FT                   SFVQKDYWLKGTIPFLESMVFNSNVSKDKAHMSVVLFAGKQRVVVPFTDESSQDKNMLL
FT                   EKINSIDEGIATSSDTLYVNALKYAIENVIFGDGTRKDAPKVAVLFYYGFDYGANKNMI
FT                   PDVVQTYKEQNVKLIIVGIALGIRDNAYLLADCSIGDENCVNVVFKPWDFVIPAAADVN
FT                   QKICDKNKS"
     atgaaaagct taaaagtggt attatgtttg ggtatgatat cagcttgtat gcttgttggt        60
     acgtatggtc gaatgaacgt agtgtctcat aactctatga aaaaggttgg ggaagaaggt       120
     aaggatgaaa agattatatc atgtgttgtg gaatatgtca tcaaggggga tttaagtatt       180
     gatgatgggg atttttgtga tagtaattcg atttgttcaa ataatcctgg tttatgtgat       240
     aatggacaag tagtagtacc aggagattat tgtagtaatt attatgatat aacattagtt       300
     gttgaagagt caagttttgt tcagaaggat tattggttaa aaggaactat accattttta       360
     gaatctatgg tctttaattc gaatgtaagt aaggataagg ctcatatgtc agttgtcctt       420
     tttgcaggta agcaaagagt agtcgttcca tttacagatg aaagtagtca agacaaaaat       480
     atgttacttg agaaaattaa ttcaatagat gaaggtatag cgacaagttc tgatacttta       540
     tatgttaatg ctttaaagta tgctatagaa aatgtgatat ttggagatgg cactcgaaag       600
     gatgctccta aggttgctgt attattttat tatggatttg attatggagc taataaaaat       660
     atgattccag atgttgtaca aacatataaa gaacaaaacg ttaaactaat aattgttggt       720
     atagctttag gaattagaga taatgcatat ttacttgctg actgttctat tggtgatgaa       780
     aattgtgtaa atgtggtatt taaaccctgg gattttgtta tacctgccgc agcagatgta       840
     aatcaaaaaa tatgtgataa gaataaatca taa                                    873
//

If you have problems or comments...

PBIL Back to PBIL home page