(data stored in ACNUC9543 zone)

EMBL: AL844507.PE120

AL844507.PE120       Location/Qualifiers
FT   CDS_pept        complement(618843..620228)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0812300"
FT                   /product="sporozoite surface protein 3, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0812300"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0088:mRNA"
FT                   /db_xref="GOA:Q8IAV9"
FT                   /db_xref="InterPro:IPR010884"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAV9"
FT                   /protein_id="CAD51251.1"
FT                   /translation="MPNMLLYIFFLIFFSFYNPVKGEGYICDFSSEKYNIYFDEQKDDV
FT                   ICYHEIYEGDSIGIIIPRYKEGNENIYIKTNCFNEVSLESSGNNALSIYDIFNDDEITL
FT                   YDQDSIFYTEYISSILHIKKVKKNTYLHCVFESKDVNGLTTHKGIAKITIKNVKHNENK
FT                   KLINNDVDNNSSLSFKKKLTNKLVIDLLNKIDIIKDDKLNNQYNNDDNKFLVEAKPGDI
FT                   LYLLGVKRKNKKYLYVDQDCPLHFERIGSIYKYIFPIINEKEEIYNCTLYVDDDVSTNK
FT                   KIVGNLKITFVSKNPSINDINIDVLKKYIHSDIEQKLYKLLYGEISNSVNKYAEQNVDI
FT                   NNTDISAIQFMNLNSDNCNNNECIEFFNNSTCSSYCGKGYRLLNGNNHMYDEQMVVPCY
FT                   NGECKPEDEIEPLYIFAHTSMVFFCIIFTILILTIYNLMKTEKKNKVNDDPFITYDSNL
FT                   SKK"
     atgccgaaca tgttgttata tatatttttt cttatctttt tctcttttta taatcctgta        60
     aagggtgaag gatatatttg tgacttttcg tcggaaaaat ataatatata ttttgatgaa       120
     cagaaagatg atgtaatatg ctatcatgaa atatatgaag gagatagtat tggaataatt       180
     attcctagat ataaagaagg taatgaaaat atatatatca aaacaaattg ttttaatgaa       240
     gtatcattgg aatcatcagg aaataatgca ttatctatat atgatatatt taacgatgat       300
     gagataactt tatatgatca agattctata ttttatactg aatatatatc atctatttta       360
     catataaaaa aagtgaagaa aaatacatat cttcattgtg tatttgaaag taaggatgtg       420
     aatggcttaa ctacacataa aggtatagca aagattacaa taaaaaatgt aaaacataat       480
     gagaataaaa agttaattaa taatgatgta gataataatt cttctctttc attcaaaaag       540
     aaattaacaa ataaacttgt tattgatttg ttaaataaaa tagatataat taaagatgat       600
     aaattgaata atcaatataa taatgatgat aacaaatttc ttgttgaagc aaaaccagga       660
     gatatccttt acttgttagg agtaaaaaga aaaaataaaa aatatcttta tgtagatcaa       720
     gattgtccat tacattttga aaggattgga agtatatata aatatatttt ccctataata       780
     aatgaaaaag aggaaatata taattgtact ctatatgttg atgatgatgt aagtacaaac       840
     aaaaaaattg tgggtaattt aaaaattacg tttgtatcca aaaatccaag tattaatgat       900
     atcaatatag acgttttaaa aaaatatatt catagtgata tagaacaaaa attatacaaa       960
     cttttatatg gagaaatttc aaatagcgta aataaatatg cagaacaaaa tgtagatata      1020
     aataataccg atatatccgc aattcaattt atgaatctta attctgataa ttgtaataat      1080
     aacgaatgta ttgaattctt taataattca acatgttcat catattgtgg taagggatac      1140
     agattattaa atggtaataa tcatatgtat gatgaacaaa tggttgttcc ttgttacaat      1200
     ggggaatgta aaccagaaga tgaaatcgaa cctttatata tctttgctca tacatctatg      1260
     gttttcttct gtattatctt taccatatta attcttacca tatataattt aatgaaaaca      1320
     gaaaaaaaaa ataaagttaa tgatgatcca ttcataactt acgattcaaa tttgagtaaa      1380
     aaatag                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page