(data stored in ACNUC9543 zone)

EMBL: AL844507.PE122

AL844507.PE122       Location/Qualifiers
FT   CDS_pept        complement(626069..628945)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0812500"
FT                   /product="RNA-binding protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0812500"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0086:mRNA"
FT                   /db_xref="GOA:Q8IAW1"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035542"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAW1"
FT                   /protein_id="CAD51249.1"
FT                   /translation="MFFNFSRKKKSEERLEEERSNTCEETEQVEETSNNKRGRKQKEKD
FT                   EKAKSVEDNLDEEYDVGKNKTQEKKKRKYTRKTGATATTNNTTTTTKRGRKSKKEKDEE
FT                   IEENEKKNEVKDENVNNIGKSDDNEEKDNKENKDENYEMKITEELKDKDAKASALTLEI
FT                   LGDIPDADMKPPENILFVCKLNPVTEEEDLKIIFSRFGNIKSCKIIKDKVTNNSLQYGF
FT                   IEFEKKEDCLNAYFEMDNVVIDDRRIHVDFCQSLSKYKNEYLKDNMNNDNVNNKKQKWD
FT                   EATCKKEENNEDNIRVFKYESDHNTKEPNNDRNKKKDSKEDLENLKYKKYDNDNKRNYF
FT                   SKYKYDKDYNYNNNDKKFSHHYYRNNSYKYKNSHNHNFMYSKNQYYRKNLNYYDNKNKY
FT                   YKNIHNAAIGKRNYSPTDMIKRNNYNRRNSRSFSPRDRRTRGEGNMKDYDRYKKKEHEH
FT                   KNTQEHIDNEQKKQNEDEISNYENKTNDEHKTNEESYKRSIEGSTKNENLKNDKVTKSA
FT                   SKSFDKPDIYDVDYNDDISDYEKEKNTKNEKRSESNSTFKVSSRRSNRRTSQNSSINNK
FT                   TEHESYNRKESNKYYENKKRKYNDYQNKDNTNYHYPVKEYDNDRKGKHPSYAEEDRNYK
FT                   RRNYEDKYIDKYKDKFPDKYRDKFSDKYTDKNDNKYYNNNNMRKYSKYNDGYVGDNKKY
FT                   SKREDLYNYYDEKNKYNKHDLYDKEYYNKRKYSNYNTYNNNDNYNNKDFKSYREEKNTN
FT                   YHRTDDNKNYHHTDDFNKSYKHKDSKINDDHINISSKYHPNNDYRKPYDNGKDKMPYYS
FT                   KHSRISHKQDDYKYADNYRSKFNNKSYEERRLVNHRDRSLDHEKDYKYSRNNKDDNYHN
FT                   FNKKDTRRNHSKSFSESRYDYSNKYNDRKKNYKNDKYDKKVKTNNKNHDSPYERNSVSI
FT                   SKDSYTNNKKKNSYTLKTESVKSFVSRE"
     atgtttttta atttttcaag aaagaaaaaa agtgaagaga gacttgaaga agaaagaagt        60
     aatacatgtg aagagactga acaagttgaa gaaactagta ataataaaag aggaaggaaa       120
     cagaaagaaa aagatgaaaa agcaaaatct gtagaagata atttggatga agaatatgat       180
     gtaggaaaaa ataaaaccca agaaaagaag aaaagaaaat atacaaggaa aacgggtgcg       240
     acagctacga cgaacaatac tactacaaca actaagagag gtcgaaaaag taaaaaagaa       300
     aaggatgaag agattgaaga gaatgaaaaa aaaaatgaag ttaaagatga aaatgtaaat       360
     aatattggaa aaagtgatga taatgaagaa aaagataata aagaaaataa ggatgaaaat       420
     tatgagatga aaataacaga agaattaaaa gataaggatg ctaaagccag tgcccttacg       480
     ttagaaatat taggtgatat acctgatgct gatatgaaac ctcctgaaaa tattttattt       540
     gtatgtaaat taaacccagt tactgaagaa gaagatttga aaataatttt ttcaagattt       600
     ggaaatataa aatcatgtaa aattattaaa gataaagtta ctaataattc attacaatat       660
     ggatttattg aatttgaaaa aaaagaagat tgtttaaatg cttattttga aatggataat       720
     gttgtaattg atgatagaag aattcacgtc gatttttgtc agtcattatc caaatataag       780
     aatgaatatt taaaagataa tatgaataac gataatgtaa ataacaagaa acaaaaatgg       840
     gatgaagcaa catgtaaaaa agaagaaaat aatgaggata acattcgtgt ctttaaatat       900
     gaatctgatc ataataccaa agaacctaat aatgatcgaa ataaaaaaaa agattctaaa       960
     gaagatcttg agaatttgaa atataagaaa tatgataatg acaataaaag aaattatttt      1020
     tctaaatata aatatgataa agattataat tataataata atgataagaa attttctcat      1080
     cattattata gaaacaattc atataaatat aaaaatagtc ataaccacaa ttttatgtat      1140
     tccaaaaatc aatattatag aaaaaatcta aattattatg ataataaaaa taaatattat      1200
     aaaaatattc ataatgctgc tataggaaaa agaaattatt ctccaactga tatgataaaa      1260
     agaaataatt ataatcgacg taatagtcga tcattttccc caagggatag aagaacaaga      1320
     ggtgaaggga atatgaaaga ttatgatcga tataaaaaaa aagaacatga acacaaaaat      1380
     actcaagaac atatcgataa tgaacaaaag aaacaaaatg aagatgaaat aagtaattat      1440
     gagaacaaaa caaatgatga acataaaaca aatgaagaat catataaaag aagtatcgaa      1500
     ggttccacaa aaaatgagaa tcttaaaaat gataaagtta ccaaatcagc aagtaaatct      1560
     tttgataaac ctgacatata tgatgttgat tataatgatg atatatctga ttatgaaaaa      1620
     gagaaaaaca caaaaaatga aaaaagaagt gaaagtaatt caacctttaa agtgtcaagt      1680
     aggagaagta atagaagaac atcgcaaaac tcatctatta ataataaaac agagcatgaa      1740
     agctacaaca gaaaggaaag caataaatac tatgaaaaca aaaaaaggaa atataacgat      1800
     tatcagaata aagataacac caattatcat tatccggtga aagaatatga taatgataga      1860
     aaaggcaaac atccttcgta tgctgaagaa gatagaaatt ataaaagaag aaattatgaa      1920
     gataaatata tagacaaata taaagataaa tttccagata aatatagaga taaattttca      1980
     gataaatata cagataaaaa tgataataaa tattacaata ataataacat gagaaaatat      2040
     agtaaatata atgatggtta tgtaggagat aacaaaaaat atagtaaaag agaagatctt      2100
     tataactatt atgatgaaaa aaataaatat aataaacatg atttatatga taaagaatat      2160
     tataataaaa gaaaatatag caactacaat acttataata ataatgataa ttataataat      2220
     aaagatttca aatcatatag agaagaaaaa aacacaaact atcatcgaac agatgataat      2280
     aaaaattatc atcatacaga cgattttaac aaatcatata aacataaaga tagtaaaata      2340
     aatgatgatc atataaatat atcatccaaa tatcatccta ataatgatta tagaaaacca      2400
     tatgacaatg gaaaggataa aatgccttat tattctaaac atagtagaat atcacataaa      2460
     caagatgatt ataaatatgc ggataattat agaagtaaat ttaacaataa atcttatgaa      2520
     gagagaagat tagtaaatca tagagataga tcattggacc atgaaaaaga ttataaatat      2580
     tcaagaaata ataaggatga taactatcat aatttcaata aaaaagatac aaggagaaat      2640
     cattctaaat ctttttcaga gtcaaggtat gattattcta ataaatataa tgatagaaaa      2700
     aaaaattata aaaatgataa atatgataaa aaagtaaaaa ctaataataa aaatcatgat      2760
     tctccatatg aacgtaattc agttagtatt tccaaagatt cttatacaaa taataagaaa      2820
     aaaaattcat ataccttaaa aacggaatcg gtaaaatctt ttgtttcacg tgaataa         2877
//

If you have problems or comments...

PBIL Back to PBIL home page