(data stored in ACNUC9543 zone)

EMBL: AL844507.PE125

AL844507.PE125       Location/Qualifiers
FT   CDS_pept        complement(635537..635755)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0812800"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0812800"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.380:mRNA"
FT                   /db_xref="InterPro:IPR007513"
FT                   /db_xref="InterPro:IPR026939"
FT                   /db_xref="InterPro:IPR039438"
FT                   /db_xref="InterPro:IPR039713"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4U3"
FT                   /protein_id="CAX64119.1"
FT                   /translation="MTRGNQREVDRIRSSKRNDKTKQNSTVKDASKNLNVVCKLCRHSF
FT                   MCTVNQSILKEHHEKKHSKNAYEDCFS"
     atgacacgag gaaatcaaag agaagttgat agaattaggt catccaaaag aaatgacaaa        60
     acaaaacaaa atagtaccgt taaagacgct tcaaaaaatt tgaatgttgt ttgtaaatta       120
     tgtagacatt cttttatgtg tacagttaat caatctattt tgaaagaaca tcatgaaaag       180
     aaacattcga agaatgctta tgaggattgt ttttcatga                              219
//

If you have problems or comments...

PBIL Back to PBIL home page