(data stored in ACNUC9543 zone)

EMBL: AL844507.PE127

AL844507.PE127       Location/Qualifiers
FT   CDS_pept        complement(643086..644885)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0813000"
FT                   /product="conserved protein, unknown function"
FT                   /protein_id="VWP74399.1"
FT                   /translation="MSSATQLGISEREYEEALAVEKLFFLSSRERCNYCNYGKSTFVDT
FT                   FNYEFLCDKCSYRSKHKKKIGEDSISYYDVQKLEKKFGDSAYYKQHSNNNKHHHHHHHH
FT                   HNKKSSYSQEKKSKSKNRRSSTRKHIEVVTDSSDSEYDEKFKKKEKKKKKERDRDRDKD
FT                   RDKDKDKDRDRTRDRTRDRTREKSYKDNKDSKYKKKKKYDDSDDDFDDEFSLNDYDPNT
FT                   PGMIGIMNSNNMSNSDYKNNFDNNFNEFDGNHLNYNQMSEHNYHDFNAFNNNINNHIPF
FT                   DNNNNPYSKNNFHLKYMNSPSSDLANINPICSDDFNPMYFNKMNYPNNFNVKLNEDSDI
FT                   NNKMKYNNKMSMVPYDPFDNSSNGESNRYSNAMDNANYYNTTNNMNNMSNMSNMSNLNN
FT                   MNNMSNMNNMNNMSNMSNMNNRLYLLNKRSSLNNNYSPNNIKPLYNQQYSNKNLYNTLN
FT                   HNQNPLNQKMSFDNNIPSNKNKMYQNKKNSTYLLNNNLNKSNSGSGLLHSGNNMNLLCY
FT                   SQQNSLNDMNRFHDNNMYNPDFAPVNVSDKNPFSLHNMISTPNNRKSYNALNSLNSDVS
FT                   NNSISRNSFKALSYPVFDSNKKF"
     atgtcgtcag caacacaatt gggtatatca gaaagagaat acgaagaagc tttagctgtg        60
     gagaaattgt tttttttatc atcaagagaa agatgtaatt attgtaatta tggaaagtca       120
     acatttgttg acacatttaa ttatgaattt ttatgtgaca aatgttcata tagaagtaaa       180
     cataaaaaga aaataggaga agattcgata agttattatg atgtgcaaaa attagaaaaa       240
     aaattcggtg attcagctta ttataaacaa catagtaata ataataaaca tcatcaccac       300
     caccatcacc atcataataa aaaatcaagt tatagtcaag aaaaaaaatc gaaatcaaaa       360
     aatcgacgct catcaactag aaaacatata gaagtagtaa cagatagttc tgattcagag       420
     tatgatgaaa aatttaaaaa aaaagagaaa aaaaaaaaaa aagaaagaga tagagacaga       480
     gataaagata gagataaaga taaggataaa gatagagata gaacaagaga tagaacaaga       540
     gatagaacac gagaaaaaag ttataaagat aataaagata gtaaatataa aaaaaaaaaa       600
     aaatatgatg attcagatga tgattttgat gacgaattta gtttaaatga ttatgatcca       660
     aatactcctg gtatgattgg aattatgaat tcaaataata tgagtaattc agattacaaa       720
     aataatttcg ataataattt taatgaattc gatgggaatc atttaaatta taatcaaatg       780
     agcgaacata attatcatga ttttaatgca tttaataata atataaataa tcatatacca       840
     tttgataata ataacaatcc atattcaaaa aataattttc atttaaaata tatgaactca       900
     ccaagtagtg atctagctaa tatcaatcca atatgttcag atgattttaa tccaatgtat       960
     tttaataaaa tgaattatcc taataatttt aatgtgaaat taaatgaaga tagtgatata      1020
     aataataaaa tgaaatataa taataaaatg agtatggtac catatgaccc ttttgataat      1080
     agtagtaatg gtgaaagcaa tagatatagt aatgctatgg ataatgcaaa ttattataac      1140
     accacaaata atatgaataa catgagtaat atgagtaata tgagtaactt gaataatatg      1200
     aataatatga gtaacatgaa taatatgaat aatatgagta atatgagtaa tatgaataat      1260
     agattatatt tattaaataa aagaagttcc ttaaataata attattcacc aaataatata      1320
     aaacctttat ataatcaaca atattcaaat aaaaatttgt ataataccct aaatcataat      1380
     caaaatccat tgaaccaaaa aatgtctttt gataataata taccgagtaa taaaaataaa      1440
     atgtatcaaa acaaaaaaaa ttcaacatat ttattaaata ataatttaaa taaatcaaat      1500
     agtggttcag gattattaca ctcaggcaat aatatgaatt tattatgtta ttcacaacaa      1560
     aatagtttaa atgatatgaa tagatttcat gataataata tgtataatcc tgattttgcc      1620
     cctgtaaacg tttctgataa aaacccattt tctctacaca atatgatatc cacacctaac      1680
     aaccgaaaat catataatgc tttaaatagt ttaaatagtg atgtaagtaa taatagtata      1740
     agtagaaatt catttaaggc attgagttat cctgtttttg attcaaacaa aaaattttag      1800
//

If you have problems or comments...

PBIL Back to PBIL home page