(data stored in ACNUC9543 zone)

EMBL: AL844507.PE128

AL844507.PE128       Location/Qualifiers
FT   CDS_pept        complement(647316..649304)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0813100"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0813100"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0082:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAW6"
FT                   /protein_id="CAD51244.1"
FT                   /translation="MSGNVKYYYDIVTSKLYFFDILSVQWKEYNEDTFNDGYAQVNNTS
FT                   KYNEKDSVDKYSFYNTRHVQHTNKKGYKEIVHKKKDSNNQLYELTNNVSNKIMRSGNNL
FT                   IKKLKESFNISDPSTSQNDTSNVNAQSEKVIKEMSDHIYPSQNDIRNYNNENKVEYDDS
FT                   LNNYYEEEEEEEEKDNEEEIINHNSNTKEEDGEYQNNIHNNDNNTYDYNNTANNLSNIY
FT                   TDEYEQYNENGNENVYKESGNYEINDKNYYDENMNYYEEAENYDTDYKNDYEENGYYYE
FT                   QDMKNYNKENNYEYDETKKYNNNNNNNDDDDDDDDNIHSNNKTEQTDSKDTQNTKQIFY
FT                   SYEKQHKESTNPYDKIYLNEKKEDTYEYSPVVEKNEEYIKDREYGENKNKLKEYNDSTL
FT                   LKKLNKEEIQKKNSANSRDSSPSSCGSNKLSERINSLINESYSIHSLTPQHRSYLTNSS
FT                   YYYHSNHYYSNNSLSKRGSSNLIENLLSHSGTKSDNFQSFNEAENNDGKDNHTEETIMN
FT                   KKTSKVNFENIKDSKEQTFDKNKKAYKENEESNINHETNDTSEIPFVRRATRTLTFKNQ
FT                   GGLTGCLKTVHKKKQELMLSSPNGVSDIDIKIANLKRRARELAQRYKSKEYSNHDQEKN
FT                   ENMKTKFEDIVLQAQKQKREIQQMQNI"
     atgtccggga atgtaaaata ttattacgat atagtaacca gcaaattgta tttttttgat        60
     attctgagtg ttcaatggaa agaatataat gaagatactt ttaacgatgg atatgcacaa       120
     gttaataaca catccaagta taatgagaaa gatagtgttg ataaatattc attctacaac       180
     acaagacatg tacaacatac aaataaaaag ggatataaag aaatagttca taaaaaaaaa       240
     gattctaaca atcaattgta tgaattaact aataatgttt ctaataaaat tatgagaagt       300
     ggtaataatc ttataaagaa attaaaagaa tcatttaata tttctgatcc atcaacttca       360
     caaaatgata cctcaaatgt aaatgcacaa agtgagaagg taattaaaga aatgagtgat       420
     catatttatc cttctcaaaa tgatataaga aattataata atgaaaataa agtggaatat       480
     gatgactcat taaataatta ttatgaggaa gaagaagaag aagaggaaaa agataatgaa       540
     gaagaaatta ttaatcataa tagtaatacg aaagaagaag atggagagta tcaaaataat       600
     attcataata atgataataa tacttatgat tataataata cagctaataa tttatcaaat       660
     atttatacag atgaatatga acaatacaat gagaatggta atgagaatgt atataaagaa       720
     tctggaaatt atgaaataaa cgataaaaat tattatgatg aaaatatgaa ttattacgaa       780
     gaagctgaga attatgatac tgattataaa aacgattatg aagaaaatgg atattattat       840
     gaacaggaca tgaaaaatta taataaagaa aataattatg aatatgacga aacaaaaaaa       900
     tataataata ataataataa taatgatgac gatgatgatg atgatgataa tatccattcg       960
     aataataaaa cagaacaaac agattctaaa gatacacaaa ataccaaaca aattttttat      1020
     agctatgaaa aacaacataa agaaagtact aatccatatg ataaaatata tttaaatgaa      1080
     aaaaaagaag acacatatga atattcacct gttgtagaaa aaaatgaaga atatataaaa      1140
     gatagagaat atggggaaaa taaaaataag ttaaaagaat ataatgatag tacacttctt      1200
     aaaaaattaa ataaggaaga aatacagaag aagaattcgg caaattcacg tgattctagc      1260
     cctagttcat gtggttcaaa taaattaagt gaacgtataa atagtctaat aaatgaatca      1320
     tatagtattc attcacttac acctcaacat cgtagttatc ttaccaacag tagctattat      1380
     tatcatagta atcattatta tagtaataat tctttatcaa aaagaggtag ttccaattta      1440
     atagaaaatt tattaagtca tagtgggaca aaatcagata attttcagtc tttcaatgaa      1500
     gctgaaaata atgatggaaa agataatcat acagaagaaa caataatgaa taagaaaact      1560
     tcaaaagtta attttgaaaa tataaaagat tcaaaagaac aaacgtttga taaaaataaa      1620
     aaagcatata aagaaaatga agaatctaac ataaatcatg aaactaatga tacatctgaa      1680
     ataccatttg tacgtagagc aaccagaaca cttactttta aaaatcaagg agggttaact      1740
     ggatgcttaa aaacggtcca taagaaaaaa caagaattaa tgttatcatc accaaatggt      1800
     gttagcgata tagatataaa aattgcaaac cttaaaagaa gagcaaggga attagctcaa      1860
     agatataaat ccaaagaata ttcaaatcat gatcaagaaa aaaatgaaaa tatgaaaaca      1920
     aaatttgaag atatagtttt acaagcacaa aagcaaaaaa gagaaataca gcaaatgcaa      1980
     aatatatga                                                              1989
//

If you have problems or comments...

PBIL Back to PBIL home page