(data stored in ACNUC9543 zone)

EMBL: AL844507.PE129

AL844507.PE129       Location/Qualifiers
FT   CDS_pept        complement(join(651417..651510,651697..651937,
FT                   652061..652222,652360..652804))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0813200"
FT                   /product="CS domain protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0813200"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.96:mRNA"
FT                   /db_xref="GOA:Q8IAW7"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR025934"
FT                   /db_xref="InterPro:IPR037898"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAW7"
FT                   /protein_id="CAD51243.1"
FT                   /translation="MEREKHENMLMAIARDFNSVDDLIETFLTFLENKTDYFHVMLNDK
FT                   DVETLSEKYDGAILKNLLNNNNCGFKAHSREQLLIKSFRKHQINYIMRKQPYIIENEEI
FT                   KNKYLTSCDELKKIKYMPTTKDMNKEKQENSTKVNSDVHSLNVTQENHISIWNGGKTDK
FT                   YYWNQALKEINLEMPFNEEIKPNDVNVQITNTNIKIYHCGVLKLEGMFYEEVDKQECVW
FT                   SIEDKKNIIIYLEKKRENWWPCVIKGDTEIDTKNIESKKNLTDFDEKTQGQIRKFLLEQ
FT                   RMKNEGIPTPEDLRKQNIINNVLSSKGEPFGR"
     atggagagag aaaaacatga aaatatgctc atggctattg cccgggattt taattcagta        60
     gatgatttaa tagaaacttt cttaaccttt ttagaaaata agacggacta ttttcatgtt       120
     atgcttaatg ataaggatgt agaaacattg tcggaaaaat atgacggagc tatacttaaa       180
     aatttattaa ataataataa ctgtggattt aaagcacata gtagagaaca acttttaatt       240
     aagtcattta gaaaacatca aataaattat ataatgagaa aacaaccata tataattgaa       300
     aatgaagaaa taaaaaataa atatttaact tcttgtgatg aattaaaaaa aataaaatac       360
     atgccaacaa caaaagatat gaataaggaa aaacaagaaa attcaactaa agtaaattca       420
     gatgtacatt cattaaatgt tacacaggaa aatcatatat ctatatggaa cggtgggaaa       480
     acggacaaat attactggaa tcaggcccta aaagaaataa atttagaaat gccttttaat       540
     gaagaaatta aaccaaatga tgtgaatgtt caaataacca atacaaatat taaaatttat       600
     cattgtggtg tattgaaatt agaaggaatg ttttatgaag aagttgataa acaggaatgt       660
     gtatggagta tagaggataa aaaaaatatt ataatttatt tagaaaaaaa aagagaaaat       720
     tggtggccat gtgtaataaa aggcgataca gaaatagata ccaaaaatat agaatcaaaa       780
     aagaatttaa ccgattttga tgaaaaaacg caggggcaaa ttaggaaatt cctacttgag       840
     caaagaatga aaaacgaagg cattcccact ccagaagatt taagaaaaca aaatatcata       900
     aacaacgttt taagcagcaa aggagaaccg tttggcagat aa                          942
//

If you have problems or comments...

PBIL Back to PBIL home page