(data stored in ACNUC9543 zone)

EMBL: AL844507.PE13

AL844507.PE13        Location/Qualifiers
FT   CDS_pept        complement(join(104525..104620,104748..104888))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0801400"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /protein_id="VWP74285.1"
FT                   /translation="MAQYNDVNENNKEVKDDFNEASNSVEKPVYELCDKEQMKYPFFIA
FT                   PTYDYYISSNGYATTYNLPVVKKVKGKRFLGCC"
     atggctcaat acaatgatgt taatgaaaat aataaagaag tgaaggatga ttttaacgaa        60
     gcctctaata gtgtagaaaa acctgtctat gaattgtgtg ataaggaaca aatgaaatat       120
     ccttttttca tagctccaac gtacgattat tatattagtt ccaatggata tgcaacaaca       180
     tataatttac cagtagttaa aaaggtcaaa ggtaaacggt ttttgggatg ctgctag          237
//

If you have problems or comments...

PBIL Back to PBIL home page