(data stored in ACNUC9543 zone)

EMBL: AL844507.PE130

AL844507.PE130       Location/Qualifiers
FT   CDS_pept        join(656078..656087,656693..657630)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0813300"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0813300"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.95:mRNA"
FT                   /db_xref="GOA:C0H4U4"
FT                   /db_xref="InterPro:IPR041232"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4U4"
FT                   /protein_id="CAX64120.1"
FT                   /translation="MFYGKVVKPDETVVPEVKDGYSVIHLSRACLNNPEHEGKIYVQVE
FT                   DGNGCYNICCLQKNVCEDTPLDIFLMLDNDVKIKTSGSSNEVHIVGYYEVSFGQDNLDE
FT                   DEDEFEDEFDNDEVRMLTKKNTLKNSLSNGISKRKKNLENNEDDETNVGRNDEDDDDED
FT                   DEDDEDEEEDDDEEDEDDEEDDEDDDDEEEEDEEDEDEEGEDEDDEEDEEEEEEEDEEG
FT                   EDVENKKKGGDKKKNKRSLDNKSDGPLKKSKIDDEGQFEKDLVAFLKKNGKSKLTELGK
FT                   VKKPEGLKMKLGFFIKKHSNVFKFDTEGQIVSLK"
     atgttttacg gcaaagtagt taagcctgat gaaactgtag tccctgaggt taaagatgga        60
     tattcagtta ttcatttatc aagggcctgt ttaaataatc ctgaacatga aggaaagata       120
     tatgtccaag tagaagacgg aaatggatgc tacaacatat gttgcttaca aaaaaatgta       180
     tgtgaagata ctccattaga tatatttttg atgttagata atgatgtaaa aataaaaact       240
     agtggaagtt caaatgaagt ccatatcgta ggttactatg aagtgtcctt tggtcaagat       300
     aatttagacg aagatgaaga tgaatttgaa gatgagttcg ataacgacga agtaagaatg       360
     cttacaaaga aaaatacctt aaaaaattct ctttccaatg gtatatccaa aagaaaaaaa       420
     aacttagaaa acaacgaaga tgatgaaaca aacgtaggaa gaaatgacga agatgacgat       480
     gatgaagatg atgaagatga tgaagatgaa gaagaagatg acgacgaaga agatgaagat       540
     gatgaagaag atgacgaaga tgatgatgat gaagaagaag aagatgaaga agatgaggat       600
     gaagaaggag aagatgaaga tgacgaagaa gatgaagaag aagaagaaga ggaagatgaa       660
     gaaggagaag atgttgaaaa taaaaagaaa ggaggagata aaaaaaaaaa taaaagatct       720
     ttagataaca aaagtgacgg tccattaaaa aaatctaaaa ttgatgatga aggtcaattt       780
     gaaaaagatt tagtagcctt cttgaaaaaa aatggaaaaa gtaaattaac agaattaggt       840
     aaagttaaaa aaccagaagg acttaaaatg aaattaggtt tctttattaa aaaacattca       900
     aatgttttca aatttgatac tgaaggacaa attgtatcat taaaataa                    948
//

If you have problems or comments...

PBIL Back to PBIL home page