(data stored in SCRATCH zone)

EMBL: AL844507.PE136

AL844507.PE136       Location/Qualifiers
FT   CDS_pept        complement(join(677989..678381,678684..678725))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0813900"
FT                   /product="40S ribosomal protein S16, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0813900"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0076:mRNA"
FT                   /db_xref="GOA:Q8IAX5"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="PDB:3J7A"
FT                   /db_xref="PDB:3JBN"
FT                   /db_xref="PDB:3JBO"
FT                   /db_xref="PDB:3JBP"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAX5"
FT                   /protein_id="CAD51235.1"
FT                   /translation="MTTKVKRVQTFGKKKTAVAVATVTNGKGLIKLNGKNLDLVEPYIL
FT                   KTKVYEPLWLIGSGKLKNLDIRIRVKGGGQTSQIYAIRQAIGKGIISYYQKYVDESTKK
FT                   ELKDVLLRYDRSLLVGDTRRCEPKKFGGKGARARYQKSYR"
     atgacaacaa aagtaaaaag agttcaaaca ttcggcaaaa agaaaactgc cgttgctgta        60
     gcaacagtaa ccaatggtaa agggttaata aaattaaacg gtaagaattt agatttagtt       120
     gaaccctata ttttaaaaac taaagtatat gaacccttat ggttaattgg atcaggcaaa       180
     ttaaaaaatt tagatatccg tataagagtt aagggtggtg gtcaaacttc tcaaatatat       240
     gctatacgtc aagctattgg taaaggaata atttcttatt atcaaaaata tgtagatgaa       300
     tcaactaaaa aagaattaaa agatgtcttg ttaagatatg acagatcatt gttagtagga       360
     gacacaagaa gatgtgaacc caaaaaattt ggtggaaagg gtgctcgtgc aagataccaa       420
     aaatcataca gatga                                                        435
//

If you have problems or comments...

PBIL Back to PBIL home page