(data stored in ACNUC9543 zone)

EMBL: AL844507.PE137

AL844507.PE137       Location/Qualifiers
FT   CDS_pept        join(680957..681196,681402..681809)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0814000"
FT                   /product="60S ribosomal protein L13-2, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0814000"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0075:mRNA"
FT                   /db_xref="GOA:Q8IAX6"
FT                   /db_xref="InterPro:IPR001380"
FT                   /db_xref="InterPro:IPR018256"
FT                   /db_xref="PDB:3J79"
FT                   /db_xref="PDB:3JBN"
FT                   /db_xref="PDB:3JBO"
FT                   /db_xref="PDB:3JBP"
FT                   /db_xref="PDB:5UMD"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAX6"
FT                   /protein_id="CAD51234.1"
FT                   /translation="MVAHNNVLPNVHLHKWWQRHVRVNFSKNIKKKKRRLLREKRRKAN
FT                   GGTPIEKLHPIVHCPTQRYNFRTRLGKGFTFEELKGAGLTPRAAQTIGICYDKRRKNRS
FT                   EESLTKNVERLLKYKNSLVMIPLKKNKAKKGIGGIPADADKNTIKEFRNKKPLLSIFKK
FT                   EKNTKPFYETIEVSKIDKEFLAYKTLRRAKLAERRKNRRQQKKDIKFKSKDN"
     atggttgccc ataataacgt tttaccaaat gtacatcttc ataaatggtg gcaaaggcat        60
     gtaagagtta actttagtaa aaatataaaa aaaaaaaaaa gaagattgtt gagagaaaaa       120
     agaagaaaag ctaatggagg tactcctatt gaaaaattac acccaattgt acactgtcca       180
     actcaaagat ataattttag aactaggcta ggaaaaggat ttacctttga agagttaaag       240
     ggagccggat taactcctag agctgcacaa actataggta tatgctatga caaaagaaga       300
     aaaaacagat ctgaagaatc cttgacaaaa aatgtcgaaa gattattaaa gtataagaac       360
     agtttagtta tgatcccact taagaaaaac aaagcaaaga aaggtattgg aggtatccca       420
     gctgatgctg ataagaatac catcaaagaa ttcagaaata agaaaccatt actcagtata       480
     ttcaagaaag aaaagaacac taaaccattc tatgaaacta ttgaagtatc taaaattgat       540
     aaagaattct tggcctacaa aacattacgt agagctaaat tggctgaaag aagaaagaat       600
     agaagacaac aaaagaaaga tattaaattt aaatctaaag ataattaa                    648
//

If you have problems or comments...

PBIL Back to PBIL home page