(data stored in ACNUC9543 zone)

EMBL: AL844507.PE138

AL844507.PE138       Location/Qualifiers
FT   CDS_pept        complement(join(682518..682539,682647..682728,
FT                   682874..682955,683115..683164,683273..683342,
FT                   683432..683572))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0814100"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0814100"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.93:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4U6"
FT                   /protein_id="CAX64122.1"
FT                   /translation="MVKKDNIWVLCKLYLDEKNTQLNKLQEDDIFKIIQNSNTPLFVLI
FT                   KEEFDKNALIFYGKIFKTILFNPFSIIFANLELRIFIIKTSNKFKKEIEILTKFVTVCD
FT                   YLKVEILYIGVTLNKCKRFLTDLFIKLKIEENIPCIMKEFENCS"
     atggttaaaa aagataacat atgggtatta tgtaaattat atttagacga aaaaaataca        60
     cagctaaata aattacaaga agatgacata ttcaaaataa tacaaaactc aaatacaccc       120
     ttgtttgttt taattaaaga agaatttgat aagaatgctc ttatatttta tggaaaaata       180
     tttaaaacaa tactttttaa tcctttcagt atcatttttg caaatctaga attgcgaatt       240
     tttataataa aaactagtaa caaattcaaa aaggaaattg aaattttaac aaaatttgta       300
     accgtctgtg attacttaaa agttgaaata ttatacatag gtgtaaccct aaacaaatgt       360
     aaaagatttc tgacggattt atttataaaa ttaaaaattg aagaaaatat cccatgcata       420
     atgaaggaat tcgaaaactg ttcttaa                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page