(data stored in ACNUC9543 zone)

EMBL: AL844507.PE139

AL844507.PE139       Location/Qualifiers
FT   CDS_pept        687340..688086
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0814200"
FT                   /product="DNA/RNA-binding protein Alba 1"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0814200"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0074:mRNA"
FT                   /db_xref="GOA:Q8IAX8"
FT                   /db_xref="InterPro:IPR002775"
FT                   /db_xref="InterPro:IPR036882"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAX8"
FT                   /protein_id="CAD51232.1"
FT                   /translation="MKKDREPIDEDEMRITSTGRMTNYVNYGAKILGDEDKKSIKIKAT
FT                   GNAIGKAVTLAEIIKRRFKGLHQITRCGSTVITDQYVSGQDNSEHVVQEKTVSFIEILL
FT                   SREQLDMKDAGYQPPLDEKYVKEMTPEEIVNSRPFRRGGFRPRFYRGFRGGRGGFLRRG
FT                   GYRGFGDRVYEPRSSFRGGRGSGYGGNFGRGGYRSGGGMGGGFRGGFRGGFRGGRDGGY
FT                   RGGNRGGSRSGFRGGRGGFRGGRALS"
     atgaagaaag atagagaacc aatagacgaa gatgaaatga gaataacctc aaccggaagg        60
     atgaccaact atgttaacta tggtgcaaaa atactaggag atgaagacaa aaaaagtata       120
     aaaattaaag caacaggtaa tgctattgga aaagctgtaa cattagcaga aataataaaa       180
     agaagattta aaggattaca tcaaataacc agatgtggaa gtacagttat cactgatcaa       240
     tatgtaagtg gacaagataa tagcgaacat gtagtacaag aaaaaaccgt ttcatttatt       300
     gaaatattat tatctagaga acaattagat atgaaagatg caggttatca accacctttg       360
     gatgagaaat atgtaaaaga aatgacccca gaagaaattg tcaattctag gccattcaga       420
     agaggtggat ttagaccacg attttataga ggatttagag gaggaagagg tggattttta       480
     agaagaggag gatatagagg ttttggtgac agagtatatg aaccaagaag tagcttcaga       540
     ggtggaagag gtagcggata tggtggaaat ttcggaagag gtggatacag atcaggtggt       600
     ggtatgggtg gtggattcag aggtggattc agaggaggat ttagaggtgg aagagatggt       660
     ggctacagag gtggaaacag aggaggtagc agaagtggat ttagaggtgg cagaggtgga       720
     ttcagaggtg gaagagcttt atcataa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page