(data stored in ACNUC9543 zone)

EMBL: AL844507.PE14

AL844507.PE14        Location/Qualifiers
FT   CDS_pept        complement(106593..108242)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0801500"
FT                   /product="nucleolar protein 10, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0801500"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0135:mRNA"
FT                   /db_xref="GOA:Q8IAL3"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR040382"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAL3"
FT                   /protein_id="CAD51350.1"
FT                   /translation="MIKSFINNGITIYSLTSGKLNPENSNNSFGRKNKNFQKDVKNNSV
FT                   EILHDLEFPGKSDEIKISDDGRYFCISGMYPPQVGLYDTKELSIKHRRHFDEEVRTFEF
FT                   LSSNYEKIVFLCKNRYIEFHNAAGKYHKMRIPKEGRNIMYNKENCNLYICGSFDSIYNL
FT                   NLQNGCYENSLKTKNEENNFVCKNPQLPIFCTGGTEGILEIWDERIKKSINFLNMGNEY
FT                   DELTSCSFSDNGLKIAIGSEKGIVKLYDIRHNKPLFIKDHCNDLAINKIEFLKINNNKY
FT                   IYNNIDDNILYNNDNTSCNEFIASCDSNCIKVYSEKKNNLLSLQVINFNDEKKNNSSNK
FT                   KMKLLNNEFININSFTFYKNSGLCFIPCDNKKVFIYFIPIIGIAPEWCNFLDSITEELE
FT                   EKERYKKDDEIDNFSNELFDDYLFITSQQVDQLNINHLKGTKNLIPYLHGYYIPSKVYA
FT                   DIKSVIHETDFETYKKNLIQKKLEQKQQMRIPQKSTLVNKEYVDKLLNKVQKKIDKKQK
FT                   VLVDAQELLEDKRFSKLFYDPEYMVETVHLDE"
     atgataaaat cttttataaa caatggaatt acgatttatt cgttaacatc tggtaagctg        60
     aaccccgaga atagtaacaa ttcgtttggt agaaaaaata agaattttca aaaggatgtt       120
     aaaaacaatt ctgttgagat attacatgat ttggaatttc ctggaaaaag tgatgagata       180
     aaaataagtg atgacggtag atatttttgt ataagtggaa tgtatcctcc ccaagtaggt       240
     ttatatgata ctaaagagtt gtctataaaa catcgacgtc attttgatga ggaggttcga       300
     acttttgaat ttttgagtag taattatgag aagattgttt ttttgtgtaa aaatagatat       360
     atagaatttc ataatgcagc tgggaaatat cataagatgc gtattcctaa ggaaggacgt       420
     aatataatgt ataataaaga aaattgtaat ttatatatat gtggttcatt tgatagtata       480
     tataatttaa atttacaaaa tggttgttat gagaatagtt taaaaacaaa aaatgaagag       540
     aataattttg tttgtaagaa tccacaactt cctatttttt gtacaggagg aacagagggg       600
     attttagaaa tatgggacga aagaataaaa aaaagtatta attttttaaa tatgggaaat       660
     gaatatgatg aattaacatc atgttctttt tcggataatg gattgaaaat agcgataggt       720
     tctgaaaaag gtatagtaaa attatatgat ataagacata ataagccctt atttattaaa       780
     gatcattgta atgatttagc tataaacaaa atagaatttt taaaaattaa taataataaa       840
     tatatatata ataatataga tgataatatt ttatataata atgacaatac atcatgtaat       900
     gaatttattg cttcttgtga ttctaattgt ataaaagtat attcagaaaa gaaaaataat       960
     ttattatcat tacaagttat caattttaat gatgaaaaaa aaaataatag tagtaataaa      1020
     aaaatgaaat tattaaataa tgaatttata aatataaatt catttacatt ttataaaaat      1080
     tcaggattat gttttatacc ttgtgataat aaaaaagtat ttatttattt tatacctatt      1140
     attggtatag ccccagaatg gtgtaatttc ttagatagta taactgaaga gttagaagaa      1200
     aaagaaagat ataagaaaga tgatgaaatt gataattttt caaatgaact ttttgacgat      1260
     tatttattta taacaagcca acaagtcgat caacttaata ttaatcatct taaaggtacc      1320
     aaaaatttaa ttccatattt acatggatat tatataccta gtaaggtata tgcagatatc      1380
     aagagtgtta tacatgaaac ggactttgaa acatacaaaa agaatctaat acagaaaaaa      1440
     ttagaacaaa aacaacaaat gagaatacca caaaaaagta ctttagttaa taaagaatat      1500
     gtcgataaat tacttaacaa agtacaaaag aaaattgata agaaacaaaa agttctagtc      1560
     gatgcacaag aattattgga agataaaagg tttagtaaat tattttatga cccagaatat      1620
     atggtcgaaa cggtgcacct ggatgaataa                                       1650
//

If you have problems or comments...

PBIL Back to PBIL home page