(data stored in ACNUC9543 zone)

EMBL: AL844507.PE142

AL844507.PE142       Location/Qualifiers
FT   CDS_pept        700376..702652
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0814500"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0814500"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.88:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAY2"
FT                   /protein_id="CAD51228.1"
FT                   /translation="MDIVRFKEEDTNMLCCESSSNVLDNDCKTFYLLNPDGILDSVAGL
FT                   ENLYISYMNISYKPIICYKCLSFFECENNYNFIRCPKCKIINSVVPHDKLGRKVIIVIC
FT                   YQCNNRNITNIECIYIRCYLCNSLNYSKYSPFNINSTNINIDETKYDTKFNYKDKEKHK
FT                   REQKEKKKNKIKYNNNNNYYFKYNSSNKNKHNYTSKKNKNNMGKKIINLFSLSNMFTCV
FT                   KLPKDDTLTSVISSIGEKEIHSDFRYSRKDSIRSINTENNSIYNRYRINSITSINDNTS
FT                   QHMNNEEKQQNEDFIFHPNDFFNNDNFNNYLYGERLDEEYIYNTNSNNNNNNNNINNNN
FT                   NNINNINNNNNNINNNNNNNNNINNINNNNNNINNNNNNNNSQRKYFSNEPSHGYVPDG
FT                   RFIQDDNRKKFIKTSNNNNNNSYNNYNNYNNYNNYNNYNSNEPFNNEYIRNPTNNYNNI
FT                   NNNYIQKGNNNYIKMNENRNMYMKDNNKGIYNNNNNTMMMNQDYNNYKQNYYTNNQQGS
FT                   WNKDNKIYSSNDYKSNKQDNYYDRIGGLVENGNVKKKAMIFNNMTHDSSSKHHISKNQN
FT                   HLDMEKQKECDVKACIEYFNKLKKGNDINIKTILERGNYKELNIPKEHLENGLFYKNVE
FT                   FYQKHNLKNYVDHYIKPNAVMENKNNMNKDFSKHNSNEYYKNKHLSANNKNKSSDNSNI
FT                   HKSNNKNEEEKNKKNKRSANDLYDTKRANADHDDNINNKKKIKNENARKPTFYTKEELI
FT                   KDFFR"
     atggatatag tccgttttaa agaggaggat actaacatgt tatgctgtga atcctcgagt        60
     aatgtactgg ataatgattg taaaacattt tatttattaa atccagatgg tattctggat       120
     tcagtagcag ggttagaaaa tttatatata tcttatatga acatatcata taaacctatt       180
     atatgttata aatgtttatc attttttgaa tgtgaaaata attataattt tataaggtgt       240
     ccgaaatgta aaataataaa ttctgtagta cctcatgata aattaggaag aaaagttatt       300
     atagttatat gctaccaatg taataataga aacataacga atatagaatg tatctatatt       360
     cgttgttatt tatgtaattc tcttaattat tccaagtatt caccttttaa tataaatagt       420
     actaatatta atatagatga aacaaaatat gacacgaaat ttaattacaa agataaggaa       480
     aaacataaaa gagaacaaaa agaaaaaaag aagaataaaa taaaatataa caataataat       540
     aattattatt ttaaatataa tagttcaaat aaaaataaac ataattatac aagtaaaaag       600
     aataaaaata atatgggaaa gaaaataatc aacttattta gcctttccaa tatgtttaca       660
     tgtgttaaac ttccaaagga tgatacatta acaagtgtta tatcgtccat cggagaaaaa       720
     gaaattcata gtgattttag atacagtaga aaagatagta tccgaagtat aaatacagaa       780
     aataatagta tatataatag ataccgtatt aatagtatca caagtataaa tgataatact       840
     agtcaacata tgaataatga agagaaacaa caaaacgaag attttatatt tcatcctaat       900
     gattttttta ataatgacaa ttttaataat tatttatatg gagaaagatt agatgaagaa       960
     tacatatata atactaatag taacaacaac aataataata ataatattaa caataataat      1020
     aataatatta acaatattaa caataataat aataatatta acaataataa taataataat      1080
     aataatatta acaatattaa caataataat aataatatta acaataataa taataataat      1140
     aatagtcaac gtaaatattt ttctaacgaa ccttcccatg gttatgtacc tgatggaaga      1200
     tttattcaag atgataatag aaaaaaattt attaaaacaa gtaataataa caataataat      1260
     agttataata attataataa ctataataat tataataatt ataataatta taactccaat      1320
     gaacctttta ataatgaata tattaggaat ccaacgaata attataacaa cataaataat      1380
     aattatatac aaaaaggtaa taataattat ataaaaatga atgaaaatag aaatatgtac      1440
     atgaaggata ataacaaagg tatatacaat aataataata atacgatgat gatgaatcaa      1500
     gattataata attataaaca aaattattat acaaataatc aacaaggatc atggaataaa      1560
     gataataaaa tatattcatc aaatgattat aagtcaaata aacaagataa ttattatgac      1620
     cgtataggag gacttgtaga aaatggtaat gttaaaaaaa aagctatgat attcaataat      1680
     atgacacatg attcttcttc taaacatcat atttctaaaa atcaaaacca tttggatatg      1740
     gaaaaacaaa aagaatgtga tgtcaaggcg tgtattgaat attttaataa actaaaaaaa      1800
     ggtaatgata ttaatattaa aaccatacta gaacgtggta attataaaga attaaatata      1860
     ccaaaagaac atttagaaaa cggactcttt tataaaaatg tagaattcta tcaaaaacat      1920
     aatttaaaaa attatgtaga tcattatatt aaaccaaatg cagtaatgga aaataaaaat      1980
     aatatgaata aagatttttc gaagcataat agtaatgaat attataaaaa taaacatctt      2040
     agtgctaata ataaaaataa aagttcagat aactctaata ttcataaatc aaataataaa      2100
     aatgaagaag aaaaaaataa aaaaaataaa cgttcagcaa atgatttata tgatactaaa      2160
     cgtgctaatg cagatcatga cgataatata aataataaga aaaaaataaa aaacgaaaat      2220
     gcacgaaaac ctacatttta cacaaaagaa gaattaatca aggacttttt tcgttaa         2277
//

If you have problems or comments...

PBIL Back to PBIL home page