(data stored in ACNUC9543 zone)

EMBL: AL844507.PE143

AL844507.PE143       Location/Qualifiers
FT   CDS_pept        complement(703502..704683)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0814600"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0814600"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0073:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAY3"
FT                   /protein_id="CAD51227.1"
FT                   /translation="MTNIIECTFKTPPDNAKTPDNAVIWNQFQYCDEKGWYSLSNHDEI
FT                   ALRPTTFNDKRIKFLVQLPEIPSEFESILSGRYDAKAWGKEDCYVVIEGEKDVHIRLPG
FT                   FKEKINYNHTERFPTFLKNWKIIVSILNEHVTLIRINAETALIININEKKNVTVKSVDF
FT                   NNGFLCVNPHTNLAIAYGDFALSSLKKCELIQNIPHEGGKWGFFTHLFKWGHIIIPKEL
FT                   EIKLPSPGLKLIGKKIDTLAIVSIPPNIHIHVKLDGPKCIRKLEYGQDYNITAIKSSES
FT                   DVDIYILFDGHLLKYEFSFDIRLNKPEKGRSLHSAKLKCINKSKEVTSFIFQETKNCKI
FT                   LLGSNCPSDNLGHLLNSQTIAIFDAEIGEYLSHPQGLQLTSVFNTLSYPLDKE"
     atgacaaaca ttatagaatg tacgttcaag acacctccag ataacgccaa aacaccagac        60
     aatgctgtta tttggaacca atttcaatat tgtgatgaga aaggatggta ttcactatca       120
     aatcatgatg aaattgcttt gagacctact acctttaatg ataagagaat taaattttta       180
     gttcaactac cagaaattcc ctcagaattt gaatctatat tatcaggaag atatgatgca       240
     aaggcctggg gaaaagaaga ttgttatgta gtaatcgaag gtgaaaaaga tgtgcacatt       300
     agacttcctg gatttaaaga aaaaatcaat tacaatcaca ccgaaagatt tcctacgttt       360
     ttaaaaaatt ggaaaattat tgttagtata ctgaatgaac atgttacatt gatacgtata       420
     aatgcagaaa cagcacttat tataaatata aatgaaaaga aaaatgtaac tgtcaaatca       480
     gtagatttca ataatggttt cttatgtgtt aatccacata ctaatttagc aattgcatat       540
     ggagattttg ctttgagttc attgaaaaaa tgcgaactaa ttcaaaatat cccacacgaa       600
     ggagggaaat ggggattctt tactcattta tttaaatggg gacatattat tatacccaaa       660
     gaattagaaa ttaaattacc ttccccagga ttaaaattaa ttggtaaaaa aattgataca       720
     cttgcaattg tatctattcc tccaaatatt cacatacacg taaaacttga tggaccaaaa       780
     tgtataagaa aattagaata tggtcaagat tataacatta ctgctattaa aagcagtgaa       840
     tcggatgtag atatttacat actttttgat ggacatttat taaaatatga attttctttt       900
     gatatcagat tgaataaacc ggaaaaagga agatctcttc attccgcaaa attaaaatgt       960
     ataaataaaa gtaaagaagt tacttctttt atatttcaag agactaaaaa ttgtaaaata      1020
     ttgttaggtt ccaattgtcc cagtgataat cttggtcatc tattaaattc ccaaacgata      1080
     gccatttttg atgcagaaat tggagaatac ctaagtcacc cacaaggtct tcaattaacc      1140
     agtgtgttca atactttgtc atatccattg gacaaggaat aa                         1182
//

If you have problems or comments...

PBIL Back to PBIL home page