(data stored in ACNUC9543 zone)

EMBL: AL844507.PE147

AL844507.PE147       Location/Qualifiers
FT   CDS_pept        711239..714166
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0815100"
FT                   /product="heptatricopeptide repeat and RAP
FT                   domain-containing protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0815100"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0070:mRNA"
FT                   /db_xref="InterPro:IPR013584"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAY8"
FT                   /protein_id="CAD51222.1"
FT                   /translation="MIKGDEKRGKKKKKMFHFNNNRIILNSFKKFIRTGKYKDQVINYK
FT                   EIFFEKKEEKNEEDINILKLIHIEDFKICKPKKKSFNKKKIVDKEEEKKEWTPRIIHRK
FT                   DDIKNEERNEHLKLNESNINKEKENYINVGTHHSYNFNKMNSHSTKKCNNYINNNYKNP
FT                   KKNIIYLTNFTVTNSFINKKYYIIKKPKKNSDVEEDELMLHEKRSLELLNKIKWRNEQN
FT                   EDENRIVGNIEKNELYENMNGSFNNLNNGNHSDKKVHLLNSLTFDNKDKIIKKIYKSSI
FT                   NHVRDENLWKKYVQNVFIISSYLDCPDIVILFWCFSKIGYRDNRLVNLLCSIVLKKINE
FT                   LSPCAIALLLNSFKKLEIKKYDTIELLTNQFCFHLSNSTYQDIALVSNSLSFFYIYHKN
FT                   YWKKCILKLQNNSYITCPLHLCLILSAFARLDIREGNILLSFSKVAKRLVPDMSPNNLA
FT                   LIIHSFAKLKFVHPKFFNYLFQHVHKYLDKQLEIIYKVEEKITKGSNNNNNDNNNNDNN
FT                   NDNNNDNNNNNNYYDYDEDALYSKKNKTVIKHCDNYRNNVIINDNVQDKEELNKLDEHL
FT                   SGIKNVEEDKYSKNIMINNNYDAEENCKIIENKKKSYFNKEATAKHTPFVEHNNKNEIS
FT                   ENNNVNHNIKTNNSYINKCSKLNDNKKKMFDLQSLVLLLYSSTCLITCTEQMTLKLIYL
FT                   IMPHKDYLGDHKIDKLKYVSDYLQNLFPSTFETFPKNVKDFFYYIDTYEIKKKKLKYSA
FT                   RWINELSRILTKMNVDHIRNVYINNICTDIMLTSTNVIIKCLGPYSYYINSLVTTSISD
FT                   LKLKILESKKYKVINLSYHDWNKLNDYEEKIKFLYSFGRHAANIFFINNKQESVNEQRN
FT                   NQSISRSQLNKNEKGVQDIDIKLKMNYPHNMKNQNIKSHSQSSIEFDEKIQMDEHFSSD
FT                   EEDEILNFLEKQKGTMDINRNDYNDDIEKIKNYLSFPGGSNGHNA"
     atgataaaag gtgatgaaaa aaggggaaaa aaaaaaaaaa aaatgtttca ttttaacaat        60
     aaccgtatta ttttaaattc atttaagaag tttattagaa cgggtaaata taaagaccag       120
     gtaattaatt ataaagagat attttttgaa aagaaagaag aaaaaaatga agaggatata       180
     aacattttaa aattaataca tattgaggat tttaaaattt gtaaaccgaa aaagaaaagt       240
     tttaataaaa agaaaattgt tgataaagag gaagaaaaaa aggagtggac gcctcgcatt       300
     attcatagaa aggacgatat aaaaaatgaa gaaaggaacg aacatttaaa gttaaatgaa       360
     tcaaatataa ataaggaaaa agagaattat ataaatgtag gtacacatca ttcttataat       420
     tttaataaaa tgaattcaca tagtactaaa aaatgtaata attatataaa taataattat       480
     aagaatccaa aaaagaatat tatttattta actaatttta ccgttactaa tagttttatt       540
     aataaaaagt attatataat taaaaaacca aaaaaaaatt ctgatgtaga ggaggatgaa       600
     ttaatgttac atgagaaaag atcacttgaa cttttgaata aaataaaatg gaggaatgaa       660
     cagaatgagg atgaaaatag aattgtaggt aatatagaaa agaatgaatt atatgaaaat       720
     atgaatggat cgtttaataa tttgaataat ggtaatcata gtgataagaa agttcattta       780
     ttaaattcat tgacttttga taataaggat aaaattatta aaaagatata caaatcatca       840
     attaatcatg taagggatga aaatttgtgg aaaaaatatg tacagaatgt ttttattata       900
     tcttcatatt tggattgtcc tgacattgta atattatttt ggtgttttag taaaatagga       960
     tatagagata atagattagt aaatttatta tgttcaatcg ttttaaaaaa gataaatgaa      1020
     ttaagtccat gtgcgattgc attattatta aatagtttta aaaaattaga aattaaaaaa      1080
     tatgatacca tagaattatt aacaaatcaa ttttgttttc atttatcaaa tagtacatat      1140
     caagatatag ctctagtttc gaattcttta tctttttttt atatttatca taaaaattat      1200
     tggaaaaaat gtatattaaa attacaaaat aattcatata ttacctgtcc attacattta      1260
     tgtctaattt tatcagcatt cgctagactt gatataaggg aaggaaatat tttattatct      1320
     tttagtaaag ttgctaaacg tctagttcct gatatgtcac ctaataattt agctttaatt      1380
     attcattcat ttgcaaagtt aaaatttgtt catcctaaat tttttaatta tctttttcaa      1440
     catgttcata agtatttgga taagcaactt gaaataatat acaaggttga agaaaaaata      1500
     actaaaggga gtaataataa taataatgac aataataata atgacaataa taatgacaat      1560
     aataatgaca ataataataa taataattat tatgattatg atgaggatgc attatatagt      1620
     aaaaagaaca aaacagttat taaacattgc gataattata gaaacaatgt aattattaat      1680
     gataatgttc aagacaagga agaacttaat aaattggatg aacacttatc cggaattaaa      1740
     aatgtggaag aagataaata ttcaaaaaat attatgataa ataataatta tgatgcagaa      1800
     gaaaattgta aaataataga aaataaaaaa aaaagctatt ttaataaaga agcaacagca      1860
     aaacatacac cttttgttga acataataat aagaatgaaa tttctgaaaa taataatgtg      1920
     aatcataata taaagacaaa taatagttat attaataaat gctcaaaact taatgataat      1980
     aaaaaaaaga tgttcgattt acaatcactt gttttattat tatattctag tacctgttta      2040
     attacttgca cagaacaaat gacattaaaa ttaatttatt tgataatgcc acataaagat      2100
     tatttaggtg atcataaaat agataagctc aaatatgtaa gcgattatct acaaaacctt      2160
     ttcccatcca cttttgaaac atttccaaaa aatgtaaaag atttttttta ttatatagat      2220
     acatatgaaa taaaaaaaaa aaaattaaaa tatagtgcac gatggattaa cgaattatca      2280
     cgtattctaa ctaaaatgaa tgtagatcat ataagaaatg tatacataaa taatatatgt      2340
     acagatatca tgttaacttc aacaaatgtt attataaaat gtctaggccc atacagttat      2400
     tatatcaact ccttagtaac cacatcgata tctgatttaa agttgaaaat attagaaagc      2460
     aaaaaatata aagtaataaa tttaagttat catgattgga ataaattaaa tgactatgaa      2520
     gaaaaaatta aattcttata ctcttttgga cgacatgcag ccaacatttt tttcataaat      2580
     aataaacaag aatcggtaaa cgaacaaaga aataaccaat ctatatccag atcacaacta      2640
     aacaagaatg aaaagggtgt acaagatata gatataaaac taaaaatgaa ttatcctcac      2700
     aacatgaaaa atcaaaatat aaaatctcat tcacaatctt ccattgagtt tgatgaaaaa      2760
     atacaaatgg atgaacattt ttcatctgat gaagaagatg aaatattgaa ctttttggaa      2820
     aagcaaaaag gtacaatgga tataaatcga aatgattata atgatgatat agaaaaaatt      2880
     aaaaattatt tgtctttccc aggtggctca aatggacata atgcctga                   2928
//

If you have problems or comments...

PBIL Back to PBIL home page