(data stored in SCRATCH zone)

EMBL: AL844507.PE15

AL844507.PE15        Location/Qualifiers
FT   CDS_pept        complement(109180..109557)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0801600"
FT                   /product="conserved protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0801600"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0134:mRNA"
FT                   /db_xref="GOA:Q8IAL4"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAL4"
FT                   /protein_id="CAD51349.1"
FT                   /translation="MDINLEERSYTSPLLYYIYNKDDKINRISPGEMKNKSFIPYSIRL
FT                   CNLPIKNTKDNSYMSNINSLNIINMLPLSLFSNYNSNNMTSTDILFLPKFSTFLFFTIP
FT                   IFVMLPNLTLYTKHWFFYAPK"
     atggatataa atttagaaga gaggtcatat acctcgcctt tgttatatta catatataat        60
     aaggatgata aaataaatag aatttctcct ggtgaaatga agaataaaag ttttatacct       120
     tatagtataa gattatgtaa tttaccaata aaaaatacga aggataattc atatatgtct       180
     aatataaatt ctttaaatat aattaatatg ttacctttat ctttattttc taattataat       240
     agtaacaata tgacatcaac tgatatttta tttctaccaa aattttcaac ctttctattt       300
     tttaccatac caatatttgt aatgttgcct aaccttacgt tatatacaaa gcactggttt       360
     ttctatgccc ccaaataa                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page