(data stored in SCRATCH zone)

EMBL: AL844507.PE150

AL844507.PE150       Location/Qualifiers
FT   CDS_pept        complement(join(725781..726059,726299..726502))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0815400"
FT                   /product="ATP synthase-associated protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0815400"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.85:mRNA"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAZ1"
FT                   /protein_id="CAD51219.1"
FT                   /translation="MLSKGNVKNLATDEINEMIDNSLKSGDTDEAPYFLQQNNIYWETG
FT                   HRTYIPFFHFMIHKYTTKIIDDQIRKFTESVKSVHHTPYVFHKDGYFRSYYGDPDINMV
FT                   FNLKKNTNFIFNSTGTHNSYSLLCNNNTYDKSTHIFDQVLMSAFKLDLKSVLENNV"
     atgttatcga aaggaaatgt gaaaaatcta gccacagatg agataaacga aatgattgat        60
     aattctttaa aatcagggga tacagatgaa gcaccttatt ttttacaaca aaataatatt       120
     tattgggaaa caggccacag aacttatatc ccttttttcc atttcatgat acataaatat       180
     acgactaaaa ttatagatga tcaaataaga aaattcacag aaagtgtaaa gagtgttcat       240
     catacaccat atgtatttca taaggatgga tatttcagaa gttattatgg ggatccagat       300
     attaatatgg ttttcaattt aaagaaaaat acaaacttta tttttaattc aacaggtact       360
     cataattcat atagtttatt atgtaataat aatacttatg ataagtctac tcatatattt       420
     gatcaggtac ttatgagcgc ctttaaatta gacttaaaga gtgtattgga aaataatgta       480
     taa                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page