(data stored in ACNUC9543 zone)

EMBL: AL844507.PE151

AL844507.PE151       Location/Qualifiers
FT   CDS_pept        join(727662..728223,728427..728746,728873..729248,
FT                   729398..729536,729650..729728)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0815500"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0815500"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.84:mRNA"
FT                   /db_xref="GOA:Q8IAZ2"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAZ2"
FT                   /protein_id="CAD51218.1"
FT                   /translation="MVEKKIDDAPFLSKMENFEISDKKGKGSKKDMKNEYKSLNNEFHF
FT                   DEERGENDEEDKENDKDMNEGDVNKNNNKKENNHIRMIKIDRKNLKKMFSSQFFTQTLT
FT                   DDSSSNSMSELKVIKKYACVEFFKMLFLVSLFLITSYYSFIYIYNNFMGQNHICGSLDM
FT                   YNYKYEESVNFISSISNNKYYIFTGKFPFDVITYKLRKEALKNSMNEEIKKYNESNANI
FT                   IYDNISNLDDHQIQIISFNKYNNKMKCEKNIFDLYKPFYLKTTDAPIKNLDYIYNEVNY
FT                   NSISNPYNIAEKKLFSEVSTFMRANENRNKICFITSYLKSLKDEDTSNSNNVIIQNNNN
FT                   NNNNSSSSITSNGSNALDEKNNYTEENNNNEKKYFKNTNSIGDNDNNKTYQGSNIVNFN
FT                   YTNNNMVPEKKKIIFLYDQSDHNFVDLVIAIYSMQYGNTYNNLKDYWEEIKKKFKVIHA
FT                   EEIYLFEWYCLGINYNLIENNNQYKLKCVDLLK"
     atggttgaga aaaaaataga cgacgcccct tttctttcca agatggagaa ctttgaaata        60
     tctgataaga aagggaaagg ctctaaaaaa gatatgaaga atgaatataa aagtttaaat       120
     aacgaatttc attttgatga agagagaggt gagaatgatg aagaagataa agaaaacgat       180
     aaagatatga atgaaggaga tgtaaataaa aataataata aaaaagaaaa taatcatata       240
     cgtatgatta aaattgatag aaagaattta aaaaaaatgt ttagtagtca attttttaca       300
     caaacattga cagatgattc aagtagtaat tctatgtctg aattaaaagt aattaagaaa       360
     tatgcatgtg tagaattttt taaaatgtta tttcttgtat ctttattttt gataacttcg       420
     tattattcct tcatttatat ttataataat tttatgggac aaaatcatat atgtggatct       480
     ttggatatgt ataattataa gtatgaagaa tctgtaaatt ttatatcaag tataagtaat       540
     aataagtact acatatttac aggaaaattt ccatttgatg ttataacata taaactaaga       600
     aaagaggctc tgaaaaatag tatgaatgaa gaaataaaaa aatataacga atcaaatgca       660
     aatattatat atgacaatat ttcaaatttg gatgaccatc aaattcaaat aatatccttt       720
     aataaataca ataataaaat gaaatgtgag aaaaatattt ttgatttata taagcccttt       780
     tatctaaaaa ctacagatgc acctataaaa aatcttgatt atatttataa tgaggtgaat       840
     tataattcta taagtaaccc atataatata gcagaaaaaa aactattctc tgaggtgtcc       900
     acattcatga gagcgaatga aaatagaaat aagatctgct ttattacctc ttatctaaaa       960
     tccttaaaag atgaagatac ttcaaatagt aataatgtca taatacaaaa taataataat      1020
     aataataata atagtagtag tagtatcact agtaatggta gtaatgctct tgatgagaaa      1080
     aataattaca ctgaagaaaa taataacaat gaaaagaaat attttaaaaa tacaaattca      1140
     ataggcgata atgataacaa caaaacttat caaggcagta atattgttaa ttttaattat      1200
     actaataata atatggttcc agaaaaaaaa aaaattatct ttctttatga tcaaagtgac      1260
     cacaattttg tcgacttggt catagcaatt tatagtatgc aatatggaaa cacttataac      1320
     aacctaaagg attattggga agagataaaa aagaaattta aggttataca tgctgaggaa      1380
     atatacttat tcgaatggta ctgcttagga ataaattaca atttaataga aaacaataat      1440
     caatacaagt taaaatgtgt tgatctttta aaataa                                1476
//

If you have problems or comments...

PBIL Back to PBIL home page