(data stored in ACNUC9543 zone)

EMBL: AL844507.PE152

AL844507.PE152       Location/Qualifiers
FT   CDS_pept        complement(join(729917..729946,730071..730182,
FT                   730354..730421,730587..730643,730779..730844,
FT                   730965..731138,731363..731455,731631..731764,
FT                   731943..732002,732175..732187))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0815600"
FT                   /product="eukaryotic translation initiation factor 3
FT                   subunit G, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0815600"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.83:mRNA"
FT                   /db_xref="GOA:Q8IAZ3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR017334"
FT                   /db_xref="InterPro:IPR034240"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAZ3"
FT                   /protein_id="CAD51217.2"
FT                   /translation="MIQTEKKWADIDVDDDESINDNEIKKKWEDIDADDDLEANKKLSY
FT                   FTNYENGIKVVTKYSENLKKQTVKVTKKIQEVVIKKKLNKEINNRLNLKNFNIDIHSSV
FT                   TVEPTDVVNIEVPKNNPLDFLKDTEYDYLFAEQTNKTAKDLKNRFKILKDEETEDVKAE
FT                   DPSKAAGRREGLYYRPHDTQNKECTVRVTNLSEDVNENELSNLFGKVGNIVRMFLAKHK
FT                   ETQNSKGFAFITYSKREEAKRAIEKLNRHGFENLLLSVEWAKPSNR"
     atgatacaaa cagagaaaaa atgggcagat attgatgtag atgatgatga atccataaat        60
     gataatgaaa taaaaaaaaa atgggaagat atagatgcag atgatgactt agaagcgaat       120
     aaaaaattat catatttcac aaattatgaa aatggaataa aagttgttac aaaatactcg       180
     gaaaatttaa aaaaacagac tgttaaagtt accaaaaaaa ttcaagaagt tgtgattaaa       240
     aaaaaattaa acaaagaaat aaataacaga cttaacctaa aaaattttaa cattgatata       300
     catagctcag tcactgttga accaacagat gtcgttaata ttgaagttcc taaaaacaat       360
     ccattagatt ttttaaaaga taccgaatat gattatttat ttgcagaaca aacaaataaa       420
     acagctaagg atctcaaaaa tagatttaag atattgaaag atgaagaaac agaggatgtt       480
     aaggctgaag atccaagcaa agccgctgga aggagagaag gattatacta tcgcccacat       540
     gatactcaaa ataaagaatg cactgttcgt gtaacgaact taagcgaaga cgttaatgaa       600
     aatgagttat cgaacttgtt cggaaaagtg ggtaacatcg ttcgtatgtt cttggccaag       660
     cataaggaaa ctcaaaattc aaaaggtttt gcttttatta cttactccaa gagggaagaa       720
     gcaaaaaggg ctattgaaaa attgaatcgt cacggatttg aaaatttact cttaagcgtg       780
     gaatgggcca agccatcaaa cagataa                                           807
//

If you have problems or comments...

PBIL Back to PBIL home page