(data stored in ACNUC9543 zone)

EMBL: AL844507.PE158

AL844507.PE158       Location/Qualifiers
FT   CDS_pept        complement(750082..750711)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0816200"
FT                   /product="vacuolar protein sorting-associated protein 2,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0816200"
FT                   /db_xref="EnsemblGenomes-Tr:PF08_0064:mRNA"
FT                   /db_xref="GOA:Q8IAZ9"
FT                   /db_xref="InterPro:IPR005024"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IAZ9"
FT                   /protein_id="CAD51211.1"
FT                   /translation="MGTYFSKDLQECLREEKRNLNRSIRELEREIFKMENEKKQIEKNI
FT                   RIHAKKNDITLVRTLAKDLVKIKQNVIKYNKIKSHLLSMKIKLQSVKSSEQLNKSLCDI
FT                   NNIIKRVNKYIQVKNINNSIYEFQKQNNEVSIKEDMIDDLFDTLNYDIDMIQEEDEIVS
FT                   KVLDELGIQLNSKLEQIPTIKQTENEQLDNVNISKIEDRINNLKKM"
     atgggaactt atttttccaa agatctgcaa gaatgcctaa gggaggagaa acgaaatttg        60
     aatcgttcga tcagagaatt agagagagag atatttaaaa tggaaaatga aaaaaaacaa       120
     atagaaaaga acataagaat acatgcaaag aagaatgata taaccttagt acgtacctta       180
     gcaaaagatc tagtaaaaat aaaacagaac gttataaaat ataataaaat aaaatctcat       240
     ttattatcga tgaaaataaa attacaaagt gttaaatctt cagaacaatt aaataaaagt       300
     ttatgtgata taaacaatat aattaaaagg gtaaataaat atattcaagt taaaaatatt       360
     aataactcca tatatgaatt tcaaaaacaa aataatgaag tctccataaa agaagatatg       420
     atagacgact tatttgatac actgaattat gatatagata tgattcaaga agaagacgaa       480
     attgtttcca aggtattaga tgaattaggt atacaactca attcaaaatt agaacaaatc       540
     cctacaatca aacaaacaga aaatgaacaa cttgacaatg ttaatatatc aaaaattgag       600
     gatagaataa acaatttgaa aaaaatgtga                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page