(data stored in ACNUC9543 zone)

EMBL: AL844507.PE159

AL844507.PE159       Location/Qualifiers
FT   CDS_pept        complement(join(751942..754235,754409..754433,
FT                   754555..754611,754696..754742,754938..755001,
FT                   755091..755122,755223..755345,755497..755716,
FT                   755823..755933,756147..756173))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0816300"
FT                   /product="conserved Plasmodium protein, unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0816300"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.80:mRNA"
FT                   /db_xref="GOA:C0H4U8"
FT                   /db_xref="InterPro:IPR018928"
FT                   /db_xref="InterPro:IPR040326"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4U8"
FT                   /protein_id="CAX64125.1"
FT                   /translation="MDRLNKYLSRQKYVVRRSEGSPYRNFLLYVEEIYQVTVVYPIKYL
FT                   FDIPLKYYEYFKSYKKKDIDNKNLKQFCNIIKEQHEINNEQQKCFCCYCRQDDMVFPLF
FT                   SHFNYKKAKFKCNKKEQEEDIVLTLSCLKKKDKIFHSFFIQQNYNFFMLNVTLQQFDLN
FT                   DEYFININDKSTLERKTYLLDSSNYEIDDEVFNVKIKFNVQKNYRNDDIEGNYLFVDSN
FT                   IFKDRIILEDSFKDGDILKNSVIVKSHHVDEHGLTCNKIIGYPIYWNRGKGLCRLKRNE
FT                   CFHKQVSTFLNLEKKLSSKNNMSYNYSFFMIRKLHMDEYNEIDEGFEKTNEYIYNINKL
FT                   NKINEIIDDYKYNNTDRYKYDIKIDNNENLLEYIKNNYYIGLQKERHHFIDIKSHNEEI
FT                   LNISYDEEGIGESVSFVHILSNCYNYNNEKKNISCSIYISIWNEEDIEKEINVFIKCKQ
FT                   RIVNDITQLNKKLFLCKKCEETILIKFEPIYNMLLASCHVLITKEERNLDIKNIYEDPN
FT                   IRGANYKEQHFLFVKDEENVEASHNYKYKKGKYKTYDYDDDMVNMDQRVQNKEYHKIDK
FT                   IYNNNNNNNNDNIYHKNVYIIKEVPLKFDEQFYRPNDHNIMLLYNTMNFVENVEDYILR
FT                   YKRKFFFFINKSGNIVKIILFLFLVIILCIFIIPSLPFCTYFFIKLKWFHKLKTIRLLI
FT                   LWKVQDTFTFFKKIPRKVWRFIKKIAKKCKRVLFKIFIKYKKDQELIDQEYKEKLQRKR
FT                   KKERKKKQIRKKYQLQKKEKEILRKKRYKKLIENEKIFQKEMKKELMHKRNNKIKHENK
FT                   HEENYYINNKNDHTYGHKSKTQKHYKKYHDKYEDKYHHKYHKKEPKQKNIYNHLNNPHN
FT                   PSYNDLEKNQSLTSNTNSSQEYYEKKKYENTLSSAEHINIKNTHHKSKLNTFNNKNTYD
FT                   NQYIKKEPYDKDNIYSDFYAIKNNDQQSILQEKKKNRRSISNISKIYKNNDTIQLSNKD
FT                   SKTSRKDLLP"
     atggataggt tgaacaagta tttgtctaga caaaaatatg tagttcgtag gagcgaaggt        60
     tctccataca gaaattttct tttgtatgtt gaggaaattt atcaagttac tgtggtgtac       120
     cctattaaat atctttttga tattcctcta aaatattatg aatatttcaa gtcctataaa       180
     aagaaagata tagataataa aaatttaaaa caattttgta atataattaa agagcaacat       240
     gaaataaata atgaacaaca aaaatgtttc tgttgttatt gtcgtcaaga tgatatggta       300
     tttccattat tttctcattt taattataaa aaagcaaagt ttaaatgtaa caagaaagaa       360
     caagaagagg atatagttct gaccttgtct tgtttgaaaa agaaagacaa aatttttcat       420
     tcttttttca tacaacaaaa ttacaacttt tttatgttaa atgttacatt acaacaattt       480
     gatttgaatg acgaatattt cataaacata aatgataagt ctactctaga aagaaaaact       540
     tatctccttg attcttcaaa ttatgaaata gatgacgaag tatttaatgt aaagataaaa       600
     tttaatgtcc aaaaaaatta cagaaatgac gatattgagg gcaactacct ttttgtggac       660
     tcaaatattt ttaaggatag gataatatta gaagactcat ttaaagatgg agatatttta       720
     aaaaattcag ttattgtaaa atctcatcat gttgatgaac atggacttac atgtaacaaa       780
     ataattggtt atccgattta ttggaataga ggaaaaggat tgtgtcgatt aaaaagaaat       840
     gaatgttttc ataaacaggt ttctacattt ttaaatttag aaaagaaatt aagctcgaaa       900
     aataatatga gctataatta ttctttcttt atgataagaa agttacatat ggatgaatat       960
     aatgagatag atgaaggttt tgaaaaaacg aatgaatata tatataatat aaataaactt      1020
     aataaaataa atgaaataat agatgattat aagtataata atacggatag atataaatat      1080
     gatattaaga ttgataataa tgagaactta ttagaatata taaaaaataa ttattatatt      1140
     ggtttacaaa aagaaagaca tcattttata gatataaaat cacataatga agaaatatta      1200
     aatatatcat atgacgagga aggtatagga gagtccgtat cctttgtaca tatattaagt      1260
     aattgttaca attataataa tgaaaaaaaa aatatctcat gtagtattta tataagtata      1320
     tggaatgaag aagatataga gaaagaaata aatgttttta taaaatgtaa acaaaggatt      1380
     gttaatgata taacacaact aaataaaaaa ttatttttat gtaaaaagtg tgaagaaact      1440
     attcttataa aatttgaacc tatatataat atgttgctag catcatgtca tgttttaata      1500
     acaaaagagg aaagaaatct tgatataaaa aatatatatg aagatcctaa tattaggggt      1560
     gcaaattata aagagcaaca ttttcttttt gttaaagatg aagaaaatgt agaggcatcg      1620
     cataattata aatataaaaa aggaaaatat aaaacttatg attatgatga tgatatggta      1680
     aatatggatc aaagagtaca aaataaagaa tatcataaga tagataaaat atataataat      1740
     aataataata ataataatga taatatatac cacaaaaatg tatacattat taaagaagta      1800
     cctcttaaat tcgatgaaca attctatagg ccaaacgatc ataacataat gttattatat      1860
     aatacaatga actttgttga aaatgtagaa gattatattt taagatataa aaggaaattc      1920
     ttttttttta taaacaaatc agggaatatt gtaaaaataa ttttattctt attcttagtt      1980
     attatattat gtatttttat aataccaagt ttacctttct gtacatattt ttttattaaa      2040
     ttaaaatggt ttcataaact aaaaacaatt cgtctattga tattatggaa agtacaagat      2100
     acattcacat tttttaaaaa gatacccagg aaagtatgga gattcataaa aaaaattgca      2160
     aaaaaatgta aacgggtgct ttttaaaata tttataaaat ataaaaagga tcaagaactt      2220
     attgatcaag aatataaaga aaaattacaa agaaaaagaa aaaaagaaag aaaaaaaaaa      2280
     caaatcagaa aaaaatatca acttcaaaaa aaggagaagg aaattttgag aaaaaaaaga      2340
     tataaaaagt tgattgaaaa tgaaaaaata tttcaaaagg aaatgaaaaa agaattaatg      2400
     cataaaagaa ataataaaat aaaacacgaa aacaaacatg aagaaaatta ttatataaac      2460
     aacaaaaatg atcatacata tggtcataaa agtaaaacgc agaaacatta taaaaaatat      2520
     catgataaat atgaagataa atatcatcat aaatatcata agaaagaacc aaaacaaaaa      2580
     aatatatata atcatttaaa taatcctcat aatccatcat ataacgattt agaaaaaaat      2640
     caatcattaa cttcaaacac aaattcttct caagaatatt atgaaaagaa aaaatatgaa      2700
     aatactcttt catctgctga acatataaat ataaaaaaca ctcatcataa aagtaaatta      2760
     aatactttta ataataaaaa cacatatgat aaccaatata ttaaaaaaga accatatgat      2820
     aaggataata tatattctga tttctatgct ataaaaaaca atgaccaaca aagtattctc      2880
     caagaaaaaa agaaaaatag aagaagcata tccaacatat caaaaattta taaaaataat      2940
     gataccatac aactatctaa taaggatagt aaaactagta gaaaagatct tttaccataa      3000
//

If you have problems or comments...

PBIL Back to PBIL home page