(data stored in ACNUC9543 zone)

EMBL: AL844507.PE160

AL844507.PE160       Location/Qualifiers
FT   CDS_pept        join(757224..757743,757831..757994,758190..758207)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0816400"
FT                   /product="EF-hand calcium-binding domain-containing
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0816400"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.79:mRNA"
FT                   /db_xref="GOA:C0H4U9"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4U9"
FT                   /protein_id="CAX64126.1"
FT                   /translation="MQRVLNKSYVCFFRGIKTSHIISNDIKRNCCFFDFNKIKNDDKYE
FT                   AFGINKKYITRYWAEHTNKKIHESKINEWREQFPILADYDDKDLMIWRNSFNNMDKDKD
FT                   NFISHADLQKSDWSLEKYTLFQNYDMDKNNLIDFGEYIQAIIDIDTQHFKNFFQGFSKI
FT                   DIELEFEKYAITEKENNKKVIPLSKLMQMITDKEFTCVTETDSLKLFKSMDMNKDGSID
FT                   FEDFLQWVGKK"
     atgcaaagag ttttaaataa atcttacgtc tgctttttta ggggaattaa aacctcccac        60
     attatatcaa atgatataaa aagaaattgc tgtttttttg actttaataa aataaagaat       120
     gatgataaat atgaagcgtt tggtataaat aaaaaatata taactcgcta ttgggcagaa       180
     catacgaata aaaaaatcca tgaatcaaaa attaatgaat ggagagaaca gtttcccata       240
     ttagctgatt atgatgataa agatttaatg atatggagaa attctttcaa taatatggat       300
     aaagataaag ataattttat atcacatgca gatttacaaa aaagtgattg gagtttagaa       360
     aagtatacac ttttccaaaa ttatgatatg gataaaaata atttaataga ctttggagaa       420
     tatatacaag ctattataga tatagacaca caacacttta aaaatttctt tcagggattt       480
     agtaaaatag acattgagtt ggaattcgaa aaatacgcaa ttactgaaaa ggaaaataat       540
     aaaaaggtta tccccctttc gaagttaatg caaatgataa cagacaaaga gttcacatgt       600
     gtaacagaaa cggactcact aaaactattt aaatctatgg atatgaataa agatggatcg       660
     atagattttg aggatttcct ccagtgggta ggaaaaaagt ga                          702
//

If you have problems or comments...

PBIL Back to PBIL home page