(data stored in ACNUC9543 zone)

EMBL: AL844507.PE161

AL844507.PE161       Location/Qualifiers
FT   CDS_pept        join(760138..760212,760320..760692,760961..761031)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0816500"
FT                   /product="small heat shock protein HSP20, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0816500"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.78:mRNA"
FT                   /db_xref="GOA:Q8IB02"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB02"
FT                   /protein_id="CAD51208.1"
FT                   /translation="MSCLCAGSTDQGEMKMAPPDYRIDIKEKPSIPKSKNALVNPNTVL
FT                   EIEPDNNLKKQITFRPKVDIMYDADKCEAILVLDIPGFKIEDIDVEIGEGMLTVAGPRS
FT                   QTELFETYGDSLVLHAKEREVGYFKRIFKLPNNILDDTAKATYKNGILEIKMECKQFSD
FT                   MHKVTINQG"
     atgagttgtc tttgtgctgg ttctactgac caaggagaaa tgaaaatggc tcctcctgat        60
     tatagaatag atataaaaga gaaaccatct attcctaaga gcaaaaatgc cttagtaaat       120
     ccaaacacag tattggaaat tgagcctgac aataacttga agaaacaaat tacatttaga       180
     cctaaagtcg atataatgta tgatgcagat aaatgtgaag ctatattagt tttagatatt       240
     ccaggattta aaatagaaga tatagatgta gaaataggtg aaggtatgtt gactgtggct       300
     ggaccaagat cccaaacaga attatttgaa acatatggag atagtttagt tctacatgca       360
     aaggaaagag aagttggata ttttaaaaga atatttaaat taccaaataa tatactagac       420
     gatactgcaa aggcgacata taaaaatggt attttggaaa taaaaatgga gtgcaaacaa       480
     ttttctgata tgcacaaggt tacaattaat caaggttaa                              519
//

If you have problems or comments...

PBIL Back to PBIL home page