(data stored in ACNUC9543 zone)

EMBL: AL844507.PE163

AL844507.PE163       Location/Qualifiers
FT   CDS_pept        join(767110..767239,767323..767507,767665..767758,
FT                   767858..767880)
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0816700"
FT                   /product="trafficking protein particle complex subunit
FT                   2-like protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0816700"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.77:mRNA"
FT                   /db_xref="GOA:C0H4V0"
FT                   /db_xref="InterPro:IPR006722"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4V0"
FT                   /protein_id="CAX64127.1"
FT                   /translation="MSIKSICYLGDNNDILFFYSVEENDEITSRFALYCTLNNIQKIIE
FT                   SNEKKSSEKKYDPYLGYVGINLSLFSSYKNYAYVIKIINLKIILTIDDSKNKYTDDILK
FT                   SIFIKLHKIYADTVCNPFYTDTLETDTFLKKIKKLMETS"
     atgtctataa agagcatatg ttatttagga gataataatg atatcttatt tttttattcg        60
     gtcgaagaaa atgatgaaat aacatcacga tttgctctat attgtactct gaataatatt       120
     caaaaaataa ttgaatcaaa tgaaaagaaa agcagcgaaa aaaagtatga tccatatctt       180
     ggatatgtag gtatcaatct ttctcttttt agttcttata aaaattatgc atatgtaatt       240
     aaaattatta accttaaaat tatattaaca attgatgata gtaaaaataa gtatacagat       300
     gatatcctca aatcgatttt cataaaactg cataaaattt atgcagacac agtttgtaac       360
     cccttctata cagacacatt agaaacagat acgtttttaa aaaaaattaa aaaattaatg       420
     gaaacatcat ga                                                           432
//

If you have problems or comments...

PBIL Back to PBIL home page