(data stored in ACNUC9543 zone)

EMBL: AL844507.PE164

AL844507.PE164       Location/Qualifiers
FT   CDS_pept        complement(join(767916..767949,768132..768258,
FT                   768365..768517,768675..768750,768845..769006,
FT                   769095..769490,769697..769792))
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0816800"
FT                   /product="meiotic recombination protein DMC1, putative"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0816800"
FT                   /db_xref="GOA:Q8IB05"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR011940"
FT                   /db_xref="InterPro:IPR013632"
FT                   /db_xref="InterPro:IPR016467"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033925"
FT                   /db_xref="UniProtKB/TrEMBL:Q8IB05"
FT                   /protein_id="CAD51205.2"
FT                   /translation="MATLPASKSASKVALTSEVEDEGIKEHTFQEIEKLQDLGINAADI
FT                   NKLKGSGYCTILSLIQTTKKELCNVKGISEAKVDKILEVASKIENCSSFITANELVQKR
FT                   SKVLKITTGSTVFDQTLGGGIESMCITELFGENRCGKTQVCHTLAVTAQLPKSLNGGNG
FT                   KVCYIDTEGTFRPEKVCKIAERYGLDGEAVLDNILYARAFTHEHLYQLLAISAAKMCEE
FT                   PFALLVVDSIISLFRVDFSGRGELSERQQKLNKTMSILSKLSEQFNIAILITNQVMSDP
FT                   GATMTFIANPMKPVGGHVIGHASTIRLSLRKGKGDQRVCKVYDAPNLPEVECIFQLSDK
FT                   GVIDATD"
     atggctacat tacctgcaag taaatcggct agtaaagttg ctttaacatc agaagtagag        60
     gatgaaggga taaaggaaca tacatttcaa gaaattgaaa aattacaaga cttaggtata       120
     aacgctgcag acataaataa attgaaagga agcggttatt gtacaattct ttctttaatt       180
     caaacaacaa aaaaagagtt atgcaacgtt aagggtatat ctgaagcgaa ggttgacaaa       240
     atattagagg ttgcttccaa gatcgaaaat tgttcgagct ttattacagc taatgagttg       300
     gtacaaaaaa ggagtaaagt gttgaagata acaacaggaa gtacagtatt tgatcaaaca       360
     ctaggaggtg gaatagaaag tatgtgtatc acagaactgt ttggagaaaa tcgatgtgga       420
     aaaacacaag tatgtcatac gttagctgtc acagctcagt taccaaaaag tcttaatggg       480
     ggaaacggaa aggtttgtta tattgatact gaaggaacgt tcagacctga aaaagtttgt       540
     aaaattgctg agagatatgg attagatggg gaagcagtat tggataatat tttatatgct       600
     agagctttta cacatgagca tttgtatcaa ctactagcca tatcggcagc gaaaatgtgt       660
     gaagagccct ttgcccttct cgtagttgat tcgattattt cactctttcg tgttgatttc       720
     agtggaagag gggaattgtc tgagaggcaa cagaaattaa acaaaacaat gtctatttta       780
     tcaaaactaa gtgaacaatt caacatagct atattaataa caaatcaagt tatgtccgac       840
     ccaggtgcaa cgatgacctt catagctaac ccaatgaaac cagttggtgg gcatgttatt       900
     ggtcatgctt cgaccataag attatcatta agaaaaggga aaggagacca aagagtttgc       960
     aaagtttatg atgcaccaaa tcttcctgaa gtggaatgta tctttcaatt atcggataaa      1020
     ggtgtcattg atgcaacaga ttaa                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page