(data stored in ACNUC9543 zone)

EMBL: AL844507.PE166

AL844507.PE166       Location/Qualifiers
FT   CDS_pept        772568..773737
FT                   /transl_table=1
FT                   /locus_tag="PF3D7_0817000"
FT                   /product="NEDD8-activating enzyme E1 catalytic subunit,
FT                   putative"
FT                   /EC_number="6.2.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:PF3D7_0817000"
FT                   /db_xref="EnsemblGenomes-Tr:MAL8P1.75:mRNA"
FT                   /db_xref="GOA:C0H4V1"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR023318"
FT                   /db_xref="InterPro:IPR030468"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:C0H4V1"
FT                   /protein_id="CAX64128.1"
FT                   /translation="MDKLICTKSFERLNILVVGCGGLGNEVIKNLIFLHIKNICIVDYD
FT                   IVEVSNLQRQLFFSHDDIGKYKVDVISYKIKETYMHENICIKSYKNHIEEFDTSFFEDF
FT                   DYIIGCLDNIKGRIYLNNIIYNLRKDIIYIDGGIEGFKGNVKIINRKKNYACIQCSIEN
FT                   YTNSTYPMCSIINNPKTPEECILYVLNVSFKKEKHEELNINNIQHIQWVYEEAKKRAQY
FT                   FHIENVTYNLTEQVITNTIPTTISTLMIISSLIINILYKLVLYKNENFPYSDILYVGDN
FT                   GIYTYYYHIYKDPQCVICNKKKINFTLHKNYTLNDLIELIKRTYLCEKINISSDTCILY
FT                   ISSKCVSKIYNHKLQLTLSQLIDMGQIKENGYLNIQTDKSNYILFFNLV"
     atggacaagt taatatgcac taaatctttt gaaagattaa atatactggt ggtaggatgt        60
     ggaggtttag gtaacgaagt aataaagaat ttaatttttt tacatataaa aaatatatgt       120
     attgtagatt atgatattgt tgaagtaagt aatttacaaa gacaattatt ttttagccat       180
     gatgatatag gtaaatataa agtggatgtc ataagttata aaataaagga aacatatatg       240
     catgagaaca tttgtataaa aagttataaa aatcatatag aagaatttga tacttcattt       300
     tttgaagatt ttgattatat tattggttgc ttagataata taaagggtcg catatattta       360
     aacaatataa tatataattt aaggaaggat attatatata ttgatggagg tatagaaggt       420
     tttaaaggaa atgtaaaaat tattaataga aaaaaaaatt atgcttgtat acaatgtagt       480
     atagagaatt atacaaatag tacatatcct atgtgttcca taataaataa tcctaaaaca       540
     cctgaagaat gtattttata tgtattgaat gtttctttta aaaaagagaa acatgaagaa       600
     ttaaatataa ataatataca acatatacaa tgggtatatg aagaagccaa aaaaagagct       660
     caatattttc atatagaaaa tgtaacatac aatttaacag aacaagttat aacaaataca       720
     attcctacta ctataagtac attaatgata atttcttcat taataataaa tattttgtat       780
     aaactggttc tatataaaaa cgaaaatttc ccatatagtg atattttata tgtaggggat       840
     aatggtatat atacatatta ctatcacatt tataaagatc cacaatgtgt tatttgtaat       900
     aaaaaaaaaa ttaatttcac attacataaa aattatacat taaatgattt aattgaactt       960
     ataaagagaa catatctatg tgaaaaaatt aatatttcat cagatacttg tatattatat      1020
     atatcatcaa aatgtgtgag taaaatatat aatcacaaat tacagttgac tctttctcaa      1080
     ttaatagata tgggacaaat aaaagaaaat ggatacttaa atattcaaac ggataaaagc      1140
     aattatatac tattttttaa tttggtatga                                       1170
//

If you have problems or comments...

PBIL Back to PBIL home page